KEGG   Arabidopsis thaliana (thale cress): AT5G22030Help
Entry
AT5G22030         CDS       T00041                                 

Gene name
UBP8
Definition
ubiquitin-specific protease 8
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AT5G22030 (UBP8)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT5G22030 (UBP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 913 aa AA seqDB search
MNGTSPDESPDSTTQRIDSFNGEQRVYFVPLRWWKDAQDSMPSESVEKREILYTASCGSS
YGGPMKLINNIFNSDILFDLRREGDALQNGETGEASVSGRDFALVSSDMWLQALKCIRSN
DSFMEFFVFSASVHSLENEFLKKRLRYHDDKNTEKGVKSFSAGGVDRGDVYPVQLRLSVL
QETNSLAWSARLSFDKMIKNLNWILDNSVECFRRACKIFSLDSEQLRIWDISGQTTLFFE
SDVSNSKDCQQQADQEILLELQIYGLSDSIKLKESKKEDGSTQQTNGITNGMNGGTVFRF
GRSNSLSFLGKAGEAGTLGLTGLQNLGNTCFMNSSLQCLAHTPKLVDFFLGEYSKEINLD
NPLGMKGEIALAFGDLLRSLWAPGASTVAPRTFKAKLARFAPQFSGFNQHDSQELLAFLL
DGLHEDLNRVKNKPYVEAKDGDGRPDAEVADEYWRNHVARNDSIIVDVCQGQYKSTLVCP
ICKKVSVMFDPFMYLSLPLPCTSMRTMDLTVMSADGSSLPIPLTVNVPKFGKFEDLHKAL
VTACSLPEEETLLVTEVYNNRIIRFLEEPTDSLTLIRDGDKLVVYRLKKDANNSPLIVYM
HQKLEEQFISGKSSPTWKAFGIPLVSRLCDVENGSDVENLYLKLLSSFKMPTEFFTENLE
NPTEEEATDKTDTDGTTSVEDTNSTDVKETTESLPDPVLRLYLTDDRGNSIEAEMLKEKP
VNKSKRLNVLARWPVKELDVYDTCLLSSLPEVSKSGTKRPQESVSLFKCLEAFLTEEPLG
PDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFMKNKLEAYVDFPLDNLDLS
SYISYKNGQTTYRYMLYAISNHYGSMGGGHYTAYVHHGGDRWYDFDDSHVHQISQEKIKT
SAAYVLFYKRLVD
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggacatcgcccgacgaatctcccgattcgacaactcagcggatcgattcgttc
aacggcgagcagagagtctacttcgttcccttgaggtggtggaaagatgcgcaagattca
atgccttctgaatcagttgaaaaaagagagatcttgtatacagcaagttgcgggtcgtct
tatggaggcccaatgaagttgataaataacatttttaactctgatattttgttcgatctg
aggagagaaggagatgcgttacagaatggtgaaacgggagaagcaagcgtctcaggcagg
gactttgctttggtctcaagtgatatgtggctgcaggcactaaaatgtatccgatcaaat
gattcttttatggaatttttcgtattttctgcatctgttcattctttggagaacgagttt
ttaaagaagaggctgaggtatcatgatgataaaaatactgagaaaggcgtaaaaagtttc
tcggctggaggagttgacagaggtgatgtttatcctgtacaactcaggctctccgttttg
caggaaaccaattcattggcgtggagtgcacgactttcctttgataaaatgattaaaaat
ctaaactggattctggacaattcagttgaatgcttcagaagagcatgcaagatattcagt
ttggattctgagcagttgcgcatttgggatatttctggccaaacaaccttgtttttcgaa
agtgatgtgagcaattccaaggattgtcaacaacaagcagatcaggaaatcctcctagag
ctgcagatttatggattatcagactccatcaaattgaaggaatcaaaaaaagaagatggt
tccacacagcaaaccaatgggattaccaatggcatgaatggtggcacagtgttcagattt
ggacgaagtaattctttgagctttttgggtaaagctggagaagctggaactttggggttg
acaggcttgcagaatctaggaaacacttgtttcatgaacagttcccttcagtgcttggct
cacacaccgaagcttgtcgacttctttcttggcgagtacagtaaagaaataaatcttgac
aatccattgggaatgaaaggtgagatcgccttagcttttggtgacttgttaaggagtctg
tgggctccaggtgcatcaacagtggccccaaggacatttaaagcaaaacttgctcgcttt
gctcctcagtttagtggctttaatcagcatgattcgcaggagcttctagctttcttgctg
gatggactccacgaggacttaaaccgtgtaaagaacaagccttacgtggaagcaaaagat
ggagatggccgtccagacgcagaagtggctgatgaatattggcgaaatcatgtggctcgc
aatgattcaataattgttgatgtgtgccaaggccaatacaagtcaacattagtttgtcct
atttgcaaaaaggtttctgttatgtttgatccgttcatgtacctatcgctaccattgcca
tgcacatcaatgcgaacaatggatttaacagtcatgagtgccgatgggagtagtttgcct
attccattgactgtcaacgttcctaagtttggaaaatttgaagatcttcataaggctctt
gtcactgcctgttctttaccagaggaggagactttattggttactgaggtatacaacaat
cggattattcgcttcctggaggagcctactgattcattaaccttgatcagagatggtgac
aaacttgtcgtgtatcggttaaagaaggatgcaaacaattctcctttaattgtgtatatg
catcagaagctggaagagcagtttatatctgggaaatctagcccaacttggaaggcattt
ggaatccccttggtctcaaggctttgtgatgtcgagaatggatctgatgtcgagaacctg
tacctgaagctgcttagttcatttaagatgcctactgaattctttacagagaatcttgaa
aacccaactgaagaagaagccactgataaaacagataccgatggtactacttcagttgag
gatacaaattccactgatgtgaaggagactactgaatctcttccagatcctgtgttgagg
ctttacctcaccgacgacagaggaaactcgatagaagctgaaatgttgaaagaaaagcct
gtaaataaatccaagcggttgaatgtgcttgcacgttggcctgtaaaagagcttgacgtt
tatgatacttgtcttctgagctccttacctgaggtttccaaatctggaactaagagaccc
caagaatccgtttcgcttttcaagtgccttgaagcattcttgacggaggagcctcttggt
cctgatgacatgtggtattgtcctgggtgcaaagaacaccggcaagccattaaaaagtta
gatctctggaggttgccagagatcctggttattcatctgaagaggttttcgtatagccgg
tttatgaagaacaagctggaggcatatgtggatttcccgctagataatcttgatctatca
agctacatctcctacaagaatggtcagacaacatatcgttacatgctctatgcgattagc
aatcactatgggagcatgggaggtggtcattacactgcatatgttcaccatggaggtgat
cgatggtatgactttgatgatagccatgtccaccaaatcagccaagaaaagatcaagacc
tcggctgcttacgttctgttctataaacgccttgtagactaa

DBGET integrated database retrieval system