KEGG   Arabidopsis thaliana (thale cress): AT5G22030Help
Entry
AT5G22030         CDS       T00041                                 

Gene name
UBP8
Definition
(RefSeq) ubiquitin-specific protease 8
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
5
AA seq 913 aa AA seqDB search
MNGTSPDESPDSTTQRIDSFNGEQRVYFVPLRWWKDAQDSMPSESVEKREILYTASCGSS
YGGPMKLINNIFNSDILFDLRREGDALQNGETGEASVSGRDFALVSSDMWLQALKCIRSN
DSFMEFFVFSASVHSLENEFLKKRLRYHDDKNTEKGVKSFSAGGVDRGDVYPVQLRLSVL
QETNSLAWSARLSFDKMIKNLNWILDNSVECFRRACKIFSLDSEQLRIWDISGQTTLFFE
SDVSNSKDCQQQADQEILLELQIYGLSDSIKLKESKKEDGSTQQTNGITNGMNGGTVFRF
GRSNSLSFLGKAGEAGTLGLTGLQNLGNTCFMNSSLQCLAHTPKLVDFFLGEYSKEINLD
NPLGMKGEIALAFGDLLRSLWAPGASTVAPRTFKAKLARFAPQFSGFNQHDSQELLAFLL
DGLHEDLNRVKNKPYVEAKDGDGRPDAEVADEYWRNHVARNDSIIVDVCQGQYKSTLVCP
ICKKVSVMFDPFMYLSLPLPCTSMRTMDLTVMSADGSSLPIPLTVNVPKFGKFEDLHKAL
VTACSLPEEETLLVTEVYNNRIIRFLEEPTDSLTLIRDGDKLVVYRLKKDANNSPLIVYM
HQKLEEQFISGKSSPTWKAFGIPLVSRLCDVENGSDVENLYLKLLSSFKMPTEFFTENLE
NPTEEEATDKTDTDGTTSVEDTNSTDVKETTESLPDPVLRLYLTDDRGNSIEAEMLKEKP
VNKSKRLNVLARWPVKELDVYDTCLLSSLPEVSKSGTKRPQESVSLFKCLEAFLTEEPLG
PDDMWYCPGCKEHRQAIKKLDLWRLPEILVIHLKRFSYSRFMKNKLEAYVDFPLDNLDLS
SYISYKNGQTTYRYMLYAISNHYGSMGGGHYTAYVHHGGDRWYDFDDSHVHQISQEKIKT
SAAYVLFYKRLVD
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggacatcgcccgacgaatctcccgattcgacaactcagcggatcgattcgttc
aacggcgagcagagagtctacttcgttcccttgaggtggtggaaagatgcgcaagattca
atgccttctgaatcagttgaaaaaagagagatcttgtatacagcaagttgcgggtcgtct
tatggaggcccaatgaagttgataaataacatttttaactctgatattttgttcgatctg
aggagagaaggagatgcgttacagaatggtgaaacgggagaagcaagcgtctcaggcagg
gactttgctttggtctcaagtgatatgtggctgcaggcactaaaatgtatccgatcaaat
gattcttttatggaatttttcgtattttctgcatctgttcattctttggagaacgagttt
ttaaagaagaggctgaggtatcatgatgataaaaatactgagaaaggcgtaaaaagtttc
tcggctggaggagttgacagaggtgatgtttatcctgtacaactcaggctctccgttttg
caggaaaccaattcattggcgtggagtgcacgactttcctttgataaaatgattaaaaat
ctaaactggattctggacaattcagttgaatgcttcagaagagcatgcaagatattcagt
ttggattctgagcagttgcgcatttgggatatttctggccaaacaaccttgtttttcgaa
agtgatgtgagcaattccaaggattgtcaacaacaagcagatcaggaaatcctcctagag
ctgcagatttatggattatcagactccatcaaattgaaggaatcaaaaaaagaagatggt
tccacacagcaaaccaatgggattaccaatggcatgaatggtggcacagtgttcagattt
ggacgaagtaattctttgagctttttgggtaaagctggagaagctggaactttggggttg
acaggcttgcagaatctaggaaacacttgtttcatgaacagttcccttcagtgcttggct
cacacaccgaagcttgtcgacttctttcttggcgagtacagtaaagaaataaatcttgac
aatccattgggaatgaaaggtgagatcgccttagcttttggtgacttgttaaggagtctg
tgggctccaggtgcatcaacagtggccccaaggacatttaaagcaaaacttgctcgcttt
gctcctcagtttagtggctttaatcagcatgattcgcaggagcttctagctttcttgctg
gatggactccacgaggacttaaaccgtgtaaagaacaagccttacgtggaagcaaaagat
ggagatggccgtccagacgcagaagtggctgatgaatattggcgaaatcatgtggctcgc
aatgattcaataattgttgatgtgtgccaaggccaatacaagtcaacattagtttgtcct
atttgcaaaaaggtttctgttatgtttgatccgttcatgtacctatcgctaccattgcca
tgcacatcaatgcgaacaatggatttaacagtcatgagtgccgatgggagtagtttgcct
attccattgactgtcaacgttcctaagtttggaaaatttgaagatcttcataaggctctt
gtcactgcctgttctttaccagaggaggagactttattggttactgaggtatacaacaat
cggattattcgcttcctggaggagcctactgattcattaaccttgatcagagatggtgac
aaacttgtcgtgtatcggttaaagaaggatgcaaacaattctcctttaattgtgtatatg
catcagaagctggaagagcagtttatatctgggaaatctagcccaacttggaaggcattt
ggaatccccttggtctcaaggctttgtgatgtcgagaatggatctgatgtcgagaacctg
tacctgaagctgcttagttcatttaagatgcctactgaattctttacagagaatcttgaa
aacccaactgaagaagaagccactgataaaacagataccgatggtactacttcagttgag
gatacaaattccactgatgtgaaggagactactgaatctcttccagatcctgtgttgagg
ctttacctcaccgacgacagaggaaactcgatagaagctgaaatgttgaaagaaaagcct
gtaaataaatccaagcggttgaatgtgcttgcacgttggcctgtaaaagagcttgacgtt
tatgatacttgtcttctgagctccttacctgaggtttccaaatctggaactaagagaccc
caagaatccgtttcgcttttcaagtgccttgaagcattcttgacggaggagcctcttggt
cctgatgacatgtggtattgtcctgggtgcaaagaacaccggcaagccattaaaaagtta
gatctctggaggttgccagagatcctggttattcatctgaagaggttttcgtatagccgg
tttatgaagaacaagctggaggcatatgtggatttcccgctagataatcttgatctatca
agctacatctcctacaagaatggtcagacaacatatcgttacatgctctatgcgattagc
aatcactatgggagcatgggaggtggtcattacactgcatatgttcaccatggaggtgat
cgatggtatgactttgatgatagccatgtccaccaaatcagccaagaaaagatcaagacc
tcggctgcttacgttctgttctataaacgccttgtagactaa

DBGET integrated database retrieval system