KEGG   Arabidopsis thaliana (thale cress): AT5G22220Help
Entry
AT5G22220         CDS       T00041                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K06620  
transcription factor E2F3
Organism
ath  Arabidopsis thaliana (thale cress)
Module
Cell cycle - G1/S transition
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    AT5G22220 (E2F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 469 aa AA seqDB search
MSEEVPQQFPSSKRQLHPSLSSMKPPLVAPGEYHRFDAAETRGGGAVADQVVSDAIVIKS
TLKRKTDLVNQIVEVNELNTGVLQTPVSGKGGKAKKTSRSAKSNKSGTLASGSNAGSPGN
NFAQAGTCRYDSSLGLLTKKFINLIKQAEDGILDLNKAADTLEVQKRRIYDITNVLEGIG
LIEKTLKNRIQWKGLDVSKPGETIESIANLQDEVQNLAAEEARLDDQIRESQERLTSLSE
DENNKRLLFVTENDIKNLPCFQNKTLIAVKAPHGTTLEVPDPDEAGGYQRRYRIILRSTM
GPIDVYLVSQFEESFEDIPQADEPSNVPDEPSNVPDVPSNLPSTSGLPENHDVSMPMKEE
STERNMETQEVDDTQRVYSDIESHDFVDGIMKIVPPDLDMGVDYWFRSEVGEVSITDMWP
DESGPDWNQMITFDQDHAGPSDNKILEQPQTPSSPTPEESTATRSPTGS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaagtacctcaacaattcccatcttctaagcggcagcttcatccttctctt
tcttctatgaagcctcctctagttgctcctggtgagtatcaccggtttgatgcggcggag
actcgcggtggtggagctgttgctgatcaggttgtctctgacgcgattgtgatcaaatct
actctgaagcgtaagacagatttggtaaaccaaatagttgaggtcaatgaattgaatacc
ggtgttcttcaaacacctgtatcagggaaaggggggaaagccaagaaaacttctaggtct
gcgaagtctaataagtctggaacgctagcttctggctctaatgcaggttctcctggaaat
aactttgcacaggccggtacttgtcgatatgatagttcgttaggtcttttgacaaagaaa
tttatcaatttgataaaacaagcagaggatggtattcttgatctaaacaaagcagctgat
actttagaggtacaaaagagaaggatatatgatataaccaatgtgttagaaggaataggt
ttgatagagaagacgcttaagaacaggattcagtggaagggtctcgatgtctcaaaacca
ggagaaacaatcgaaagcatagctaacctacaggatgaagtacaaaacctcgcagctgag
gaggcaagattagatgaccaaatcagagaatcacaagaaagattaacaagcttgagtgag
gatgaaaacaacaaaaggttactgttcgtcactgaaaacgacattaagaacctaccatgc
ttccagaataagacgctgatagctgtaaaggcaccgcatggaacaactcttgaggttcca
gatcctgatgaggctggtggttatcagaggaggtacagaatcattctgagaagcacaatg
ggaccaatagacgtgtacctagtcagtcaattcgaagagagctttgaggacattcctcag
gctgatgaaccttcaaatgttcctgatgaaccctctaatgtccctgatgtaccttcaaat
cttccatcaacatctggtctccctgagaaccatgatgtatctatgccgatgaaagaggaa
agcaccgaaagaaacatggaaacacaggaagttgatgatacgcaaagagtttactctgac
atcgaatctcatgactttgtcgatggtatcatgaagattgttcctccagatttggatatg
ggtgtagattactggtttcgatcagaggtaggcgaagtcagcatcacagacatgtggcca
gatgaatctggaccagactggaaccagatgattacatttgatcaagaccacgctggaccg
agcgacaacaaaatcttggagcagccacaaactccatcgagcccaacaccagaagaatcc
actgctacgagatcacctacaggtagctga

DBGET integrated database retrieval system