KEGG   Arabidopsis thaliana (thale cress): AT5G22290Help
Entry
AT5G22290         CDS       T00041                                 

Gene name
NAC089
Definition
(RefSeq) membrane-tethered transcription factor ANAC089
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 340 aa AA seqDB search
MDTKAVGVSKDTAASMEASTVFPGFKFSPTDVELISYYLKRKMDGLERSVEVIPDLEIYN
FEPWDLPDKSIVKSDSEWFFFCARGKKYPHGSQNRRATKMGYWKATGKERDVKSGSEVIG
TKRTLVFHIGRAPKGERTDWIMHEYCVKGVSLDDAMVVCRVRRNKEYNSGTSQKAPKPNS
SAEKHAKVQNGATSSGSPSDWDNLVDFYLAGESGEKLLAEMAESSENLQVDNDEDFFADI
LRDEIINLDEAVMTGNTPNEVPTLESASMEIRVLPLPNMIDKQMSSLLEERPSQKKKGKD
ATESLSSCFVGLYSIKSVNKARWDVIIGVVALIAMLFYLE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaaggcggttggagtttctaaggatacggcggcgtcgatggaagcgtcgacg
gtgtttcctgggtttaaattctcgccgacggatgtggagttgatttcgtattacctgaag
cggaagatggatggcttggagaggtccgttgaggttataccggaccttgagatttacaat
ttcgagccttgggatttacccgataagtcgattgtgaaatctgatagcgagtggttcttc
ttctgtgcgcgtgggaaaaagtatccacatggttcacagaacaggagagcaacgaagatg
ggatactggaaagcaactgggaaagagcgtgatgtgaagtctggttctgaggtcattgga
acaaagaggacgcttgttttccatattggtcgtgcaccaaaaggcgaaagaactgactgg
attatgcacgagtactgcgtgaaaggagtatctctggatgatgctatggttgtttgccgg
gttaggaggaacaaagaatacaatagtggtacaagtcagaaggcaccaaagccaaattca
tcagccgagaagcatgcgaaagtccaaaatggcgctacgagttcagggagcccgtctgat
tgggacaacttggttgatttttacctagcaggtgaatcaggggagaaactactcgctgag
atggcagagtcatcagaaaatctacaggtggataatgacgaggatttctttgcggatatc
ctaagagacgaaatcatcaatctcgatgaagcggtgatgacagggaacacaccaaacgaa
gtgccaacactagaatcagcatcaatggagataagggtacttcctttaccaaacatgata
gacaaacaaatgtcatcactgttagaggaaagaccatcacagaagaagaaaggaaaagac
gccacggaatcattgtcgagctgcttcgtgggtttatactcgatcaaatcagtgaacaag
gcacgatgggatgttattataggtgtagtggctctgatagcaatgttgttttatctagaa
taa

DBGET integrated database retrieval system