KEGG   Arabidopsis thaliana (thale cress): AT5G22880Help
Entry
AT5G22880         CDS       T00041                                 

Gene name
HTB2
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 145 aa AA seqDB search
MAKADKKPAEKKPAEKTPAAEPAAAAEKKPKAGKKLPKEPAGAGDKKKKRSKKNVETYKI
YIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGESSKLARYNKKPTITSREIQTAVR
LVLPGELAKHAVSEGTKAVTKFTSS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcagataagaaaccagcggagaagaaaccggcagagaaaactccggcagcc
gaaccagcagcagcggcagagaagaaaccaaaagccggaaagaaactcccgaaggaacca
gccggcgccggagacaagaagaagaagagatcaaagaagaacgttgagacatacaagatc
tacatcttcaaggtgttgaagcaagttcatccagatatcggaatctccagcaaagccatg
ggaatcatgaacagtttcatcaatgatatctttgagaaacttgctggtgagtcttcgaag
cttgcgaggtacaacaagaagccgacgattacttctagggagattcagactgcggtgaga
cttgtgttgcctggagagttggcgaaacatgctgtttctgaagggactaaggcggttacg
aagtttacgagttcttag

DBGET integrated database retrieval system