KEGG   Arabidopsis thaliana (thale cress): AT5G23270Help
Entry
AT5G23270         CDS       T00041                                 

Gene name
STP11
Definition
(RefSeq) sugar transport protein 11
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 514 aa AA seqDB search
MAGGAFIDESGHGGDYEGRVTAFVMITCIVAAMGGLLFGYDIGISGGVISMEDFLTKFFP
DVLRQMQNKRGRETEYCKYDNELLTLFTSSLYLAALFASFLASTITRLFGRKVSMVIGSL
AFLSGALLNGLAINLEMLIIGRLFLGVGVGFANQSVPLYLSEMAPAKIRGALNIGFQLAI
TIGILAANIVNYVTPKLQNGIGWRLSLGLAGVPAVMMLVGCFFLPDTPNSILERGNKEKA
KEMLQKIRGTMEVEHEFNELCNACEAAKKVKHPWTNIMQARYRPQLTFCTFIPFFQQLTG
INVIMFYAPVLFKTIGFGNDASLISAVITGLVNVLSTIVSIYSVDKFGRRALFLQGGFQM
IVTQIAVGSMIGWKFGFNGEGNLSGVDADIILALICLYVAGFAWSWGPLGWLVPSEICPL
EIRSAGQSLNVSVNMFFTFFIGQFFLTMLCHMKFGLFYFFAGMVLIMTIFIYFLLPETKG
VPIEEMGKVWKEHRYWGKYSNNDDGDDVDDDAYF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaggggcatttatagacgagagtggccatggaggagactacgaaggtcgtgta
accgcgtttgtcatgataacctgcattgtagctgcaatgggtggtctcctctttggttac
gacattggtatctcaggaggagtgatatcaatggaggactttctaacgaaattcttccct
gacgtgcttcgtcaaatgcaaaacaaaagagggcgtgaaacagaatattgtaaatatgac
aatgagcttcttactctcttcacttcctctctttacctcgctgctttgttcgcttctttc
cttgcctccaccattacaaggctttttggccggaaggtctcaatggttatcgggtctctc
gcttttctctctggagctcttctcaacggtttagctatcaacctcgagatgttgatcatc
gggcggttatttctcggtgtaggtgtcggattcgctaaccaatctgttcctctttacctc
tctgagatggctcctgctaagatcagaggagctctcaacattggttttcaattagcaatc
acgatcgggatcttagccgcgaacattgtcaattacgtgaccccaaagctccagaacggg
atcggatggagattatctctcggtttagctggagttccggccgttatgatgcttgtcgga
tgctttttcttgccagatacgccaaactcaatccttgaacgtggaaacaaagaaaaggct
aaggagatgctgcagaagatcagaggaaccatggaggttgagcatgagtttaatgaactt
tgcaacgcgtgtgaagccgcgaagaaagttaagcatccatggacgaacataatgcaagct
cgttatcgaccgcagctcacgttttgtaccttcatcccattcttccagcagctaaccggg
atcaatgtcattatgttctatgcacctgttctgtttaagaccatcggttttggaaatgac
gcctctctcatatccgcagttatcaccggtcttgtcaatgtcctttccaccattgtctcc
atctactccgttgacaaattcggacgaagagctttgtttcttcaaggtggttttcagatg
atcgtgacccagatcgcggtcgggtcgatgatcggatggaaatttggattcaacggggaa
ggaaatttgtcaggggttgatgcggatataatcttggcactgatatgtctctatgtggcg
ggtttcgcgtggtcatggggaccgttgggatggttagtgccgagtgagatatgtccattg
gaaattagatcagcaggacaatcgttaaacgtttcggtgaacatgttctttacattcttc
attggacaattcttcttgacgatgctttgccatatgaagtttggtttgttctatttcttc
gcgggtatggtcttgatcatgaccattttcatttacttcttgttgccggagacaaaaggt
gttccgattgaggagatggggaaagtgtggaaagagcatagatattgggggaaatatagt
aataatgatgatggtgatgatgttgatgatgatgcttatttttag

DBGET integrated database retrieval system