KEGG   Arabidopsis thaliana (thale cress): AT5G24120Help
Entry
AT5G24120         CDS       T00041                                 

Gene name
SIGE
Definition
(RefSeq) RNA polymerase sigma factor 5
  KO
K03093  
RNA polymerase sigma factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription machinery [BR:ath03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     AT5G24120 (SIGE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 517 aa AA seqDB search
MGVVSISSSAARSPLGLGNDLLTHRSSLKKPSIVAFKADDSSNSALIIPPREQVLIPAEK
HNEKKREVTRRKPCKTPKKPLSLEHNSAPSCSLGVDYNEAAARLESIYKLSPATTTLVED
DVEDGGSKAKVSRRRKRKESGEEKKVVVRNNVKKEKRMSLDKRIALKRNVQEKPVVASVD
KKVTKRQQEEEKIERLVRDYSASNDIVSLDWKKMKIPPVLSSTEHAWLFKLMQPMKALLE
VKDVLQKSLGREPREAEIAGEINMTAGEVKKKIEIGRAARNKLIKHNLRLVLFVMNKYFH
EFTNGPKFQDLCQAGMRGLITAIDRFEPKRKFRLSTYGLFWIRHAIIRSMTTSNFTRVPF
GLESVRVEIYKAKTELWFEMGRPPTEDEVVERLKITPERYREVLRAAKPVLSLNSKHSVT
QEEFINGITDVDGVGANNSRQPALLRLALDDVLDSLKPKESLVIRQRYGLDGKGDRTLGE
IAGNLNISREMVRKHEVKALMKLKHQARVDYLRQYIV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgggagttgtgtctatttcaagttcagctgcaagatctccactcgggttgggcaacgat
cttttgacacatcggtcttcacttaaaaagccatccattgttgcttttaaagccgatgat
tccagcaattcagctttgatcattcctcctcgtgagcaagttttgattcctgctgaaaag
cataatgagaagaagagagaagtaacgaggagaaagccttgtaaaaccccgaaaaaaccg
ctttccttggaacataattcggctccttcgtgttcgttaggagtagattacaatgaagct
gctgcaagacttgaaagcatatacaagcttagtcctgcaacaaccacattagtcgaggat
gatgttgaagatggcggctctaaagccaaagtttcacggaggagaaaaaggaaagaaagt
ggtgaggagaagaaagtggttgtgaggaataatgtgaagaaggaaaaacgtatgagtctt
gataaacggattgctttgaagagaaacgttcaagagaaaccagtcgttgcttctgttgat
aagaaagtaacaaagaggcagcaagaagaggagaagatcgagaggcttgtgcgggactat
tcagcttctaatgatatagtgagcttggactggaaaaaaatgaagatacctcctgttctt
tcttctactgaacatgcttggttgttcaagttgatgcaacctatgaaggctcttcttgaa
gtgaaagatgtattgcaaaagagcttgggaagagagcctagggaagctgaaatagccggg
gagatcaatatgactgcgggtgaagtaaaaaagaaaatcgaaataggtagagctgcaaga
aacaaacttattaagcacaatctccggcttgtcttgtttgttatgaacaaatactttcat
gagtttaccaacggaccaaaattccaagacctttgtcaagcgggtatgagagggcttatc
acagcaattgaccgctttgagccgaaaaggaagtttcgtctttcgacttatggtttgttt
tggattagacatgccatcatacggtcaatgacaacttcaaacttcactcgtgtcccattt
ggacttgaatcggttagagtggagatatataaagcaaagactgagctatggtttgagatg
ggaagacctccaacggaggacgaggtagttgagagactcaagataacacctgagagatac
cgtgaagtattgagggctgcaaaaccggttttgtcactaaattcaaaacattcggttact
caagaagaattcatcaacggaatcacagatgttgatggtgttggagctaataacagcaga
cagcctgctcttctcaggctcgctctcgacgatgtgctcgattcattgaagccgaaagag
agtctggttattcgacagaggtacggtcttgatggaaaaggcgacaggactctaggagag
atagctggaaatctcaacatctctagagaaatggttaggaaacatgaagtcaaggccttg
atgaagcttaagcatcaggccagagttgattaccttcgtcaatacatcgtctaa

DBGET integrated database retrieval system