KEGG   Arabidopsis thaliana (thale cress): AT5G25150Help
Entry
AT5G25150         CDS       T00041                                 

Gene name
TAF5
Definition
(RefSeq) TBP-associated factor 5
  KO
K03130  transcription initiation factor TFIID subunit 5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AT5G25150 (TAF5)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     AT5G25150 (TAF5)
   Coactivators
    SAGA/TFTC/STAGA complex
     AT5G25150 (TAF5)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     AT5G25150 (TAF5)
    STAGA complex
     AT5G25150 (TAF5)
    TFTC complex
     AT5G25150 (TAF5)
    SAGA complex
     AT5G25150 (TAF5)
    SLIK complex
     AT5G25150 (TAF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 TFIID_NTD2 ANAPC4_WD40 Nup160 eIF2A Cytochrom_D1 WD40_like PALB2_WD40 LisH FdhD-NarQ
Motif
Other DBs
NCBI-GeneID: 832586
NCBI-ProteinID: NP_197897
MIPS: AT5G25150.1
TAIR: AT5G25150
Araport: AT5G25150
UniProt: Q6S7B0
Position
5
AA seq 669 aa AA seqDB search
MDPEQINEFVVGYLKKKGFSSAAKDLESYHHQNNNGSSFTSVDYHNDPELTKLIRSFSQQ
EDDPTRYREGYSKLRSWAYNSLDLYKHELLRVMYPVFIHCYMDLVGKGHTQEARAFFNSF
RKDHEMVHLRDLQKLEGVLSPSHLEEMEFARSLRKSKVNIKFCQYSYELLLQYLHSTVST
LMLGIINEHINFQVYSGQPTSSSDDIEAVTIVGSFQDTANHINQKEIQWGLLEDSLEDRL
EKTGGLLSDSEKGQGESKDGDADDSKKRSTEIGKQGSSLKKLKKDKAGNATAKVARLETI
TVSPAPRVKPELALPVMSTDVEQSILEDLRNRVQLSSVAMPSVSFYTFVNTHNGLNCSSI
SHDGSLVAGGFSDSSIKVWDMAKIGQAGSGALQAENDSSDQSIGPNGRRSYTLLLGHSGP
VYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDAQFSPFGHYFASCSH
DRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQTGECVRIF
IGHRSMVLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLSYSGEGSL
LASGSADCTVKLWDVTSSTKLTKAEEKNGNSNRLRSLRTFPTKSTPVHALRFSRRNLLFA
AGAISKPAN
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggatccagagcaaatcaacgagttcgtcgtgggctacttgaagaagaaaggattcagt
agcgctgctaaagaccttgaatcttatcatcaccagaacaataatggtagctccttcact
tctgtcgattatcataacgatcctgagctcacgaagctcattcgctccttttctcaacaa
gaagatgatccaactcggtaccgtgaaggttacagcaaactaaggtcatgggcgtataat
tctctggatttatataagcatgaattgcttcgagtgatgtatcctgtgtttattcattgt
tacatggatctggtggggaaagggcacactcaagaagctagagccttctttaacagcttc
cgcaaagatcatgagatggtacacttacgggatcttcagaagcttgaaggcgtgctttct
ccatctcatctagaggagatggagtttgctcgttctcttagaaaaagcaaggttaacatc
aagttttgtcagtattcatatgagctgttacttcagtatctacatagtacagtatcgact
ttaatgcttggtattattaacgagcacatcaatttccaagtctactcgggacagcctact
tcctcatccgatgacatagaagctgtcaccattgtcgggagttttcaggacactgctaat
cacattaatcaaaaagaaatacagtggggattgcttgaagattcactagaagatcgcctt
gagaagacaggaggtctgctgtctgattctgagaagggacaaggagaaagtaaagacggg
gatgcagatgatagtaagaaaagatccactgaaattggaaagcaaggctcttccttaaaa
aagttgaagaaggacaaagcgggtaatgcaacagcaaaagttgcacgtctggagaccatt
acggtgtcaccggcgccgcgtgtaaaaccagaacttgccttgccagtaatgtccacagat
gtagagcaatccatccttgaagaccttagaaaccgtgtgcagttgagtagtgttgcaatg
ccatcagtcagcttttatacatttgtgaatactcataacgggttaaactgttcatctata
tctcatgatggatctctggttgctggtgggttctcagattcttcaataaaggtctgggac
atggctaagataggacaagctggcagtggtgctttgcaggctgaaaatgattcaagtgat
caaagcataggaccaaatggcagaagaagttatacattattactgggtcattcagggcca
gtttactcagccactttcagtccccctggagattttgttctatcttcttcagcagataca
acaatacgactgtggagcacaaaactaaatgctaatctcgtgtgctacaagggtcataat
taccctgtatgggatgcccagtttagccctttcggtcattactttgcaagctgttctcat
gatcgtactgcacggatttggtcaatggaccgaatacaacctcttcggataatggcaggg
catctatctgatgttgattgtgtacagtggcatcccaattgtaactacattgctaccggt
agtagtgataagacggttagactctgggatgtgcaaactggagaatgtgtccggatattc
attgggcacaggagtatggttttatcattggcgatgtctccagatgggagatatatggct
tccggtgatgaagatggcactataatgatgtgggacctctcaactgctcgctgcatcact
cctctcatgggccataattcatgtgtctggagtctctcatacagcggggagggctctctt
ctggcttctggatccgcagactgcacagtgaaactgtgggacgtcacttcaagtaccaaa
ttgacaaaggccgaggaaaagaatggaaactcgaacagattgcgctcactcaggactttc
cccaccaagtccacaccagttcacgctctccggttttctcggagaaatttgttgtttgct
gcaggagcgatctctaaacccgcaaactga

DBGET integrated database retrieval system