KEGG   Arabidopsis thaliana (thale cress): AT5G25760Help
Entry
AT5G25760         CDS       T00041                                 

Gene name
PEX4
Definition
(RefSeq) protein peroxin4
  KO
K10689  
peroxin-4 [EC:2.3.2.23]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     AT5G25760 (PEX4)
Ubiquitin system [BR:ath04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   AT5G25760 (PEX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 157 aa AA seqDB search
MQASRARLFKEYKEVQREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSV
PEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEP
DSPLNCDSGNLLRSGDVRGFNSMAQMYTRLAAMPKKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcatcaagagcgcgactgtttaaagaatacaaagaggtacagcgagagaaagta
gcagatcctgatattcaattgatctgtgacgataccaacatattcaaatggaccgctctt
atcaaaggaccttcggagactccttacgaaggcggtgtttttcagcttgctttttctgtt
cctgaaccttatcctttgcaacctcctcaagttcgattcttgaccaagatattccatcct
aatgttcatttcaagacaggagaaatatgtctcgacattttgaagaatgcttggagtcct
gcttggacgcttcagtctgtgtgtagagctatcatagcattgatggctcatcctgagccg
gacagtcctcttaactgcgactcagggaatcttctaagatctggtgatgtgagagggttc
aattcaatggcacaaatgtatacacgcctcgccgctatgcctaagaaaggatga

DBGET integrated database retrieval system