KEGG   Arabidopsis thaliana (thale cress): AT5G25780Help
Entry
AT5G25780         CDS       T00041                                 

Gene name
EIF3B-2
Definition
eukaryotic translation initiation factor 3B-2
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT5G25780 (EIF3B-2)
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AT5G25780 (EIF3B-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 714 aa AA seqDB search
MAAVVDIDVLTAQLGINWSDVNLDSIQLPPGNDFGIESDDESVYQDDQSEFDTGFGNIIV
VDHLPVVPKEKFEKLEGVVKKIYNQLGVIKENGLLMPVDPDTKMTLGYCFIEFNTPQEAQ
NAKEKSHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQERPYVPGENLQKWLTDDKARD
QLVIRFGHDTEVYWNDARQKKPEPVHKRSYWTESYVQWSPIGTYLVTLHKQGAAVWGGAD
TFTRLMRYQHSMVKLVDFSPGEKYLVTYHSQEPSNPRDASKVEIKVFDVRTGRMMRDFKG
SADEFSIGGPGGVAGASWPVFRWAGGKDDKYFAKLSKNTISVYETETFSLIDKKSMKVDN
VVDICWSPTDSILSLFVPEQGGGNQPAKVALVQIPSKVELRQKNLFSVSDCKMYWQSSGE
YLAVKVDRYTKTKKSTYSGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIH
GDQPRPDVSFYSMKTAQNTGRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFF
NVDELETMATAEHFMATDIEWDPTGRYVATSVTTVHEMENGFTIWSFNGNMVYRILKDHF
FQLAWRPRPASFLTAEKEEEIAKNLRNYSKRYEAEDQDVSLLLSEQDREKRRALNEEWQK
WVMQWKSLHEEEKLVRQNLRDGEVSDVEEDEYEAKEVEFEDLIDVTEEIVQELM
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggttgttgatattgatgtcctaacagctcagttagggattaattggtcagat
gttaatctcgattcaatccaacttcctcctggaaacgactttgggatcgaaagtgatgat
gaaagtgtttaccaagatgaccagtcagaattcgacactggattcggtaacattatcgtt
gtcgatcacctccctgttgttcccaaggagaagtttgagaaactagaaggtgttgttaag
aaaatttacaaccagttaggtgtgattaaggaaaatggactgttgatgcccgttgatccc
gatactaagatgacattgggctactgttttattgagttcaacactcctcaggaagcacaa
aacgctaaggaaaagtctcatggctacaagttggacaagtctcacatatttgctgttaat
atgttcgatgatttcgataggttgatgaatgtgaaggaggagtgggagcctcctcaagaa
aggccctatgtccctggggaaaatttgcagaagtggcttactgatgacaaagcccgggac
cagctagtcattcgttttggccatgatactgaagtttactggaatgatgctaggcagaag
aagcctgaacctgttcataagcgttcttattggacagagagttatgtgcagtggtctcca
ataggtacataccttgtgacacttcacaagcagggggcagctgtttggggtggtgctgat
acatttacgcgtctcatgcgttatcagcattcaatggtcaaactagttgatttctcgcct
ggtgagaaatatcttgtaacttaccatagccaagaaccaagcaatccgagagatgcaagt
aaagtagagattaaggtctttgatgtgagaaccgggaggatgatgagagatttcaagggt
agtgctgatgagttttcaattggaggacctggtggtgttgctggtgcctcttggcctgtt
ttcagatgggctggcggaaaagatgataaatactttgccaagctgagcaaaaacactatc
tctgtctatgagactgagactttcagcctaatagacaagaaatccatgaaggttgataat
gttgtggatatttgctggtctcccactgattcaatcctttcattgtttgttcctgaacaa
ggtggtggaaaccaaccagccaaggttgctctagtccaaatcccgagtaaggtagagctg
aggcagaagaatctcttcagtgtgagcgactgcaagatgtactggcagagtagtggagag
tatcttgctgttaaggttgatcgatacacaaaaactaagaagagtacatactctggattt
gagcttttccgtatcaaagaaagggatattccaatcgaggttcttgagctggataacaag
aacgataagatcattgctttcgcgtgggagcccaagggtcacaggtttgctgtgattcat
ggtgaccagccaagaccggatgttagtttctactcgatgaagactgcacaaaacactgga
agagtttcaaagctcgcaactttgaaggccaaacaagccaatgccctcttctggtcgccc
acaggcaagtacatcattcttgctgggttaaaaggtttcaatggccagcttgaatttttc
aacgtggatgagctcgagacaatggccacagctgaacacttcatggccacagatatcgaa
tgggacccaactggaaggtacgttgcaacctcagtgacaacagtccacgagatggagaat
gggttcaccatatggtctttcaatgggaatatggtttaccggatactgaaggatcatttc
ttccagttggcttggcgtccaagaccggcatcattcttgactgcggagaaggaagaagag
atagcaaagaacctgaggaattacagcaagaggtatgaggcagaggatcaggacgtgtcg
ttgctattgagtgaacaagacagagagaagaggagggcattgaatgaagagtggcagaaa
tgggtgatgcagtggaagtctctgcatgaagaggagaaactcgtgaggcaaaatcttcgg
gatggtgaagttagtgatgtggaagaagatgagtatgaagccaaagaagttgagtttgag
gatcttattgatgttactgaggaaattgttcaagagttgatgtaa

DBGET integrated database retrieval system