KEGG   Arabidopsis thaliana (thale cress): AT5G26030Help
Entry
AT5G26030         CDS       T00041                                 

Gene name
FC1
Definition
ferrochelatase 1
Orthology
K01772  
ferrochelatase [EC:4.99.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT5G26030 (FC1)
Enzymes [BR:ath01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  ferrochelatase
     AT5G26030 (FC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 466 aa AA seqDB search
MQATALSSGFNPLTKRKDHRFPRSCSQRNSLSLIQCDIKERSFGESMTITNRGLSFKTNV
FEQARSVTGDCSYDETSAKARSHVVAEDKIGVLLLNLGGPETLNDVQPFLYNLFADPDII
RLPRPFQFLQGTIAKFISVVRAPKSKEGYAAIGGGSPLRKITDEQADAIKMSLQAKNIAA
NVYVGMRYWYPFTEEAVQQIKKDKITRLVVLPLYPQYSISTTGSSIRVLQDLFRKDPYLA
GVPVAIIKSWYQRRGYVNSMADLIEKELQTFSDPKEVMIFFSAHGVPVSYVENAGDPYQK
QMEECIDLIMEELKARGVLNDHKLAYQSRVGPVQWLKPYTDEVLVDLGKSGVKSLLAVPV
SFVSEHIETLEEIDMEYRELALESGVENWGRVPALGLTPSFITDLADAVIESLPSAEAMS
NPNAVVDSEDSESSDAFSYIVKMFFGSILAFVLLLSPKMFHAFRNL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaacggctttatcatctgggttcaatcctctaacgaaacgtaaagatcacaga
tttcccaggtcatgctctcagagaaattctctgtctttgattcaatgcgatataaaagag
agatctttcggagagtctatgacgatcacgaatcgtggattgagttttaagacgaatgtg
tttgagcaagctcgttctgtgactggagactgttcttatgatgaaacttcagctaaagca
cgttctcatgttgttgcagaagataagattggtgtcttgcttttgaatttaggtggtcct
gaaactcttaacgatgttcaacctttcttgtataatctctttgctgatccggatattata
aggcttcctagaccatttcagtttcttcaagggactatagctaagtttatatctgttgtt
cgtgctccgaaatctaaagaagggtatgctgctattggtggtggctctcctttgcgtaaa
ataactgatgagcaagcggatgctattaagatgtctttgcaagcgaagaacattgctgct
aatgtctatgttggtatgcggtattggtatccgttcactgaggaggctgttcagcagata
aagaaggacaaaattactagacttgttgtactgccattgtatcctcagtattctatctct
acaacgggttcaagcatacgcgttctccaagatttattcaggaaagatccgtacctagct
ggagtgccggtagctattataaagtcctggtaccaaaggcgaggctatgtcaattctatg
gctgacctcattgagaaggagcttcaaactttctctgatcctaaggaggttatgatattc
ttcagtgcccatggtgttccggtcagctacgtagagaatgctggagatccgtaccagaag
cagatggaagagtgtattgacttgataatggaagagctaaaagccagaggggttcttaac
gaccataaattggcataccagagtcgtgttggccctgttcaatggctgaagccatacacc
gatgaggttcttgtcgaccttggtaagagtggtgttaagagtctactagccgttccagtc
agtttcgtgagtgagcacattgagacacttgaggagatagacatggagtatagggaatta
gctcttgagtcaggggtagagaactggggacgggtacccgcgctaggtctcacaccatcc
ttcatcaccgacttagctgatgcagtgatagaatcacttccttcagcagaagcaatgtca
aacccaaatgcagtggttgactcagaagatagcgagtcgtcagatgctttcagttacatt
gtcaagatgttcttcggttcgattctggctttcgtcctacttctctccccaaagatgttc
catgcgttccggaacctatag

DBGET integrated database retrieval system