KEGG   Arabidopsis thaliana (thale cress): AT5G26040Help
Entry
AT5G26040         CDS       T00041                                 

Gene name
HDA2
Definition
histone deacetylase 2
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AT5G26040 (HDA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 387 aa AA seqDB search
MTHTRVISTWTELTRDLAIYLLFTFFAIKVFKFLFSCNRTSEISSFSMATHPEALRRERI
LNSKLYFDVPLSKVSIIYSSSYDISFMGIEKLHPFDSSKWGRVCKFLVSDGFLEEKAIVE
PLEASKIDLLVVHSENYLNSLKSSATVARITEVAPVAFFPNFLVQQKVLYPFRKQVGGTI
LAAKLATERGWAINIGGGFHHCTAERGGGFCAFADISLCIHFAFLRLRISRVMIIDLDAH
QGNGHETDLGDDNRVYILDMYNPEIYPFDYRARRFIDQKVEVMSGTTTDEYLRKLDEALE
VASRNFQPELVIYNAGTDILDGDPLGLLKISPDGITSRDEKVFRFAREKNIPLVMLTSGG
YMKSSARVIADSIENLSRQGLIQTRPE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacacatacccgagtcatctcgacctggaccgagttaactcgcgacttagctatttac
ttgctcttcacgtttttcgcaatcaaagtcttcaaatttctcttctcctgtaatcgaacc
tctgaaatatcatcgttttcgatggcgactcatcccgaagctctccgacgagagcgaatt
ctcaacagtaaactctacttcgacgttcctctttcaaaggtttcgattatctattcatcg
tcttatgatatctcgttcatgggtattgagaaattgcacccatttgattcttccaagtgg
ggtagagtttgcaagttccttgtttcagatgggtttctggaggagaaagcaattgttgag
cctcttgaagcttcaaagattgatcttttagtggtacattctgagaactacttaaacagc
ttgaaaagcagtgccactgtcgctaggatcaccgaggttgcaccagttgcgttttttccg
aattttcttgtgcagcagaaagttctttacccattccgaaagcaggttggtgggacgatt
ctggcagctaaacttgcaacagaacgtggatgggcgataaacattggaggaggttttcat
cattgtactgctgaaagaggaggcgggttttgtgctttcgctgatatttctctctgtatt
cactttgcgtttcttcgtctgagaatctcgagggttatgataatagatcttgatgctcat
caagggaatggccatgaaacagatctcggcgatgacaaccgtgtttacattttggatatg
tacaatcccgagatataccctttcgattatagagctaggagatttatcgatcagaaagtt
gaggtcatgagcgggacgaccaccgatgagtatttgaggaaactagatgaagcccttgag
gttgcttcgcgaaacttccaaccggagttggtaatttacaatgctggcacagacatatta
gatggtgaccctctgggacttctaaagataagccccgatggcataacaagtagagacgag
aaagtcttcagatttgcaagggagaaaaatattcctcttgtgatgctaacctcaggcggg
tacatgaagtcaagcgctagagttattgcggattccattgagaatctctcacggcaaggg
ttgatccagacacgaccggaataa

DBGET integrated database retrieval system