KEGG   Arabidopsis thaliana (thale cress): AT5G27620Help
Entry
AT5G27620         CDS       T00041                                 

Gene name
CYCH;1
Definition
cyclin H;1
Orthology
K06634  
cyclin H
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AT5G27620 (CYCH;1)
  Replication and repair
   03420 Nucleotide excision repair
    AT5G27620 (CYCH;1)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AT5G27620 (CYCH;1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 336 aa AA seqDB search
MADFQTSTQRAKWIFTPQKLAERYKAANQRAVQMLEKCGTTQVEVDASGSLTYPKDKVGS
GDQADKKLKPLSADEERFMRAFYEAKVQEVCSAFAFPHKIQATALQYFKRFYLQWSVMQH
HPKEIMLTCVYAACKIEENHVSAEEIGKGINQDHRIILKYEMAVLQSLEFDLIVYAPYRA
IEGFVNNMEEFLQARDDEIQKLESLLKGATAEADKVMLTDAPLLFPPGQLALASLRIANG
VLGVIDFDRYLENIVSQPNSEHTTSELTKLLDNIEYLVKNYKCPSEKDMKHINRKLKSCL
GHSSSHDESKKREKRSKHKSHRSSNDTPNGAPPPIG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcggattttcagacatcaacacaacgggccaagtggattttcactccccagaaactg
gcagagagatataaagctgctaaccagagggcagtgcaaatgctggagaagtgtggaaca
actcaagttgaagtagatgctagtggatcactaacatatcctaaagataaagttggttca
ggagatcaagctgataagaagcttaagcctttgagtgctgatgaagaaaggttcatgaga
gcattttatgaggcaaaggtccaagaagtgtgcagtgcctttgcatttcctcacaagatt
caggcaacagccctccaatactttaagagattttatctgcaatggtctgttatgcaacat
catccaaaagagataatgttaacctgtgtgtatgcagcttgtaaaatagaggagaatcat
gtatctgctgaggaaattgggaaagggattaaccaagatcaccgaataattctcaagtac
gagatggctgttcttcagagtttggaatttgatctgattgtttatgcaccgtatcgtgca
atcgaaggttttgtcaacaacatggaggaatttcttcaagctagagatgatgaaatccaa
aaactagagagtttgctcaaaggggcgacagcagaagccgataaagttatgctcacagat
gctccactcctctttcctcctggccagttggcattggcgtcgttacgtattgcaaatggg
gttcttggagtgattgactttgataggtacctagagaacattgtttctcaaccgaactct
gagcacacgacttcagagcttacaaagttacttgataacatcgaatatttggtaaagaac
tacaagtgcccaagtgaaaaggacatgaagcatatcaaccggaagctaaaatcttgtcta
ggacatagttcttcacatgacgagagtaagaaacgggagaagagatcaaaacacaagtcc
cataggagctccaatgatacaccaaacggggcaccgccacccataggttga

DBGET integrated database retrieval system