KEGG   Arabidopsis thaliana (thale cress): AT5G28030Help
Entry
AT5G28030         CDS       T00041                                 

Gene name
DES1
Definition
(RefSeq) L-cysteine desulfhydrase 1
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AT5G28030 (DES1)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT5G28030 (DES1)
Enzymes [BR:ath01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     AT5G28030 (DES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
5
AA seq 323 aa AA seqDB search
MEDRVLIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAE
DKGLITPGKSTLIEATGGNTGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHL
TDISIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIHYRTTGPEIWRDSAGKVDILVA
GVGTGGTVTGTGKFLKEKNKDIKVCVVEPSESAVLSGGKPGPHLIQGIGSGEIPANLDLS
IVDEIIQVTGEEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLIVVIFPSG
GERYLSTELFESVRYEAENLPVE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccgcgtcttgatcaagaacgatgtcactgaattgataggtaacacaccaatg
gtgtatctaaataaaattgtggatggttgtgtggctcgtattgctgccaagcttgagatg
atggagccttgctctagcatcaaagatagaatcgcatatagtatgatcaaagatgctgaa
gacaaaggattgattactccgggaaagagtacattgattgaggcaacgggtggtaacacc
gggattggtttagccagcatcggggcttcaagaggttataaagtgatccttttgatgcct
tcaacaatgagtttagaaaggagaatcattctaagagcattaggtgcagaggttcatctc
actgacattagcataggcattaaaggacagttggagaaagctaaagagatattaagcaaa
actcccggtggttacataccacaccagtttattaatcctgaaaatccagagattcattat
agaaccacgggtccggagatttggagagattcagcagggaaagtagatatcttagtcgcc
ggtgttggaactggtggaacggttactggaacagggaagtttcttaaagaaaagaacaaa
gatattaaggtttgtgtggtggaaccttccgaaagtgcggtactcagcggaggaaaacca
ggtccacatttgatccaaggaataggctctggtgaaattccagccaatttggacttaagc
attgttgatgaaatcattcaagtgactggtgaggaagctattgaaacaaccaagcttctt
gctatcaaagaaggattattggttggaatatcctctggagcctcagctgcggctgcgtta
aaggttgcaaagcggcctgaaaacgtagggaaactcattgtggttatttttcctagtgga
ggagaacgttatttatcgactgaattgttcgagtcagtcagatatgaagctgagaatttg
ccagttgaatga

DBGET integrated database retrieval system