KEGG   Arabidopsis thaliana (thale cress): AT5G28030Help
Entry
AT5G28030         CDS       T00041                                 

Gene name
DES1
Definition
bifunctional cystathionine gamma-lyase/cysteine synthase
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT5G28030 (DES1)
   01230 Biosynthesis of amino acids
    AT5G28030 (DES1)
  Energy metabolism
   00920 Sulfur metabolism
    AT5G28030 (DES1)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AT5G28030 (DES1)
Enzymes [BR:ath01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     AT5G28030 (DES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 323 aa AA seqDB search
MEDRVLIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAE
DKGLITPGKSTLIEATGGNTGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHL
TDISIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIHYRTTGPEIWRDSAGKVDILVA
GVGTGGTVTGTGKFLKEKNKDIKVCVVEPSESAVLSGGKPGPHLIQGIGSGEIPANLDLS
IVDEIIQVTGEEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLIVVIFPSG
GERYLSTELFESVRYEAENLPVE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccgcgtcttgatcaagaacgatgtcactgaattgataggtaacacaccaatg
gtgtatctaaataaaattgtggatggttgtgtggctcgtattgctgccaagcttgagatg
atggagccttgctctagcatcaaagatagaatcgcatatagtatgatcaaagatgctgaa
gacaaaggattgattactccgggaaagagtacattgattgaggcaacgggtggtaacacc
gggattggtttagccagcatcggggcttcaagaggttataaagtgatccttttgatgcct
tcaacaatgagtttagaaaggagaatcattctaagagcattaggtgcagaggttcatctc
actgacattagcataggcattaaaggacagttggagaaagctaaagagatattaagcaaa
actcccggtggttacataccacaccagtttattaatcctgaaaatccagagattcattat
agaaccacgggtccggagatttggagagattcagcagggaaagtagatatcttagtcgcc
ggtgttggaactggtggaacggttactggaacagggaagtttcttaaagaaaagaacaaa
gatattaaggtttgtgtggtggaaccttccgaaagtgcggtactcagcggaggaaaacca
ggtccacatttgatccaaggaataggctctggtgaaattccagccaatttggacttaagc
attgttgatgaaatcattcaagtgactggtgaggaagctattgaaacaaccaagcttctt
gctatcaaagaaggattattggttggaatatcctctggagcctcagctgcggctgcgtta
aaggttgcaaagcggcctgaaaacgtagggaaactcattgtggttatttttcctagtgga
ggagaacgttatttatcgactgaattgttcgagtcagtcagatatgaagctgagaatttg
ccagttgaatga

DBGET integrated database retrieval system