KEGG   Arabidopsis thaliana (thale cress): AT5G28030Help
Entry
AT5G28030         CDS       T00041                                 

Gene name
DES1
Definition
bifunctional cystathionine gamma-lyase/cysteine synthase
Orthology
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Class
Metabolism; Overview; Carbon metabolism [PATH:ath01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ath01230]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ath00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ath00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 323 aa AA seqDB search
MEDRVLIKNDVTELIGNTPMVYLNKIVDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAE
DKGLITPGKSTLIEATGGNTGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHL
TDISIGIKGQLEKAKEILSKTPGGYIPHQFINPENPEIHYRTTGPEIWRDSAGKVDILVA
GVGTGGTVTGTGKFLKEKNKDIKVCVVEPSESAVLSGGKPGPHLIQGIGSGEIPANLDLS
IVDEIIQVTGEEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLIVVIFPSG
GERYLSTELFESVRYEAENLPVE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccgcgtcttgatcaagaacgatgtcactgaattgataggtaacacaccaatg
gtgtatctaaataaaattgtggatggttgtgtggctcgtattgctgccaagcttgagatg
atggagccttgctctagcatcaaagatagaatcgcatatagtatgatcaaagatgctgaa
gacaaaggattgattactccgggaaagagtacattgattgaggcaacgggtggtaacacc
gggattggtttagccagcatcggggcttcaagaggttataaagtgatccttttgatgcct
tcaacaatgagtttagaaaggagaatcattctaagagcattaggtgcagaggttcatctc
actgacattagcataggcattaaaggacagttggagaaagctaaagagatattaagcaaa
actcccggtggttacataccacaccagtttattaatcctgaaaatccagagattcattat
agaaccacgggtccggagatttggagagattcagcagggaaagtagatatcttagtcgcc
ggtgttggaactggtggaacggttactggaacagggaagtttcttaaagaaaagaacaaa
gatattaaggtttgtgtggtggaaccttccgaaagtgcggtactcagcggaggaaaacca
ggtccacatttgatccaaggaataggctctggtgaaattccagccaatttggacttaagc
attgttgatgaaatcattcaagtgactggtgaggaagctattgaaacaaccaagcttctt
gctatcaaagaaggattattggttggaatatcctctggagcctcagctgcggctgcgtta
aaggttgcaaagcggcctgaaaacgtagggaaactcattgtggttatttttcctagtgga
ggagaacgttatttatcgactgaattgttcgagtcagtcagatatgaagctgagaatttg
ccagttgaatga

DBGET integrated database retrieval system