KEGG   Arabidopsis thaliana (thale cress): AT5G28237Help
Entry
AT5G28237         CDS       T00041                                 

Definition
tryptophan synthase beta chain-like protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ath01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ath00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ath00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 465 aa AA seqDB search
MSSSKIQVRGQPLLRVPARNHRMTHLVVCGVSTKRHHREINALSSNSGPSLDSVPTRTDK
RQFLRGDGNGKFGRFGGKFVPETLMSRLIELEDEFNFVRCDHEFQEELTTALRDYVGRET
PLYFAERLTEHYKNIVPTIEGGPEIYLKREDLSHCGSHKINNALAQAMISRRLGCSRVVA
ATGAGQHGVATAAACAKLSLECTVFMGAADIEKQSFNVLSMKLLGAQVISVEGTFKDASS
EAIRNWVENLYTTYYLSGTVVGPHPCPIIVREFQSVIGKETRRQAKQLWGGKPDVLVACV
GSGSNALGLFHEFVGDEDVRLVGVEAAGLGLDSGKHSATLAFGDVGVYHGSMSYLLQDDQ
GQILKPHSVGVGLEYPGVGPEISFMKETGRAEFYTATDEEAIQACMRLSRLEGIIPALEA
SHALAFLDKLVPTLRDGAKVVVNCSGRGDKDLDTLIQRGMPSSFC
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccagtaaaatccaggtacgagggcagccacttcttagggttccggcaagaaac
caccgtatgacacacttggttgtttgcggcgtttccacaaaacgccaccaccgtgaaatc
aatgcactcagcagtaatagtggtccatcgttggattcggtcccaacaagaaccgacaag
aggcagtttcttcgtggtgacggtaacggtaaattcgggaggttcggtgggaagtttgta
ccggagacattgatgtctcgcctgatagaacttgaagacgaatttaactttgttaggtgc
gatcacgaatttcaggaggagcttaccacagcgttaagagactacgtaggaagagaaacg
cctctctacttcgccgaacgtctaaccgaacactacaagaacatagttccaaccatcgaa
ggtggaccagagatatacttgaaacgggaagatcttagccactgtgggtctcacaaaatc
aataatgctctcgctcaggccatgatttcccggcggcttggttgcagccgtgtggtggcg
gccactggagccggacaacatggagtcgccacagcggctgcatgtgcaaagctctccttg
gagtgtactgttttcatgggagctgctgatatagagaaacaatcctttaatgtactttcc
atgaaactccttggtgctcaggttatatcagtggaaggaacattcaaagatgcaagttca
gaagctatacgaaactgggtcgaaaacctatataccacatactacttatcgggtacggtc
gtaggaccgcatccgtgtccgataatagtacgtgagtttcaatctgtgatcgggaaagag
acaagaaggcaagccaagcaactatggggtggtaagcctgatgtgttggtggcctgtgtg
ggaagtggctcaaacgcattgggtttgttccatgagtttgttggggatgaggatgtgcgg
ttagtcggtgtcgaggctgcggggcttggtctggattcggggaaacattcagctactttg
gcctttggagatgttggtgtataccatggttccatgagctatttattgcaagatgatcaa
ggacagatacttaaaccacactccgtaggtgttgggttagagtatcccggagttggaccg
gagattagtttcatgaaagaaactggcagagcggagttctatacagcaacagacgaagaa
gcaattcaagcgtgcatgcgattaagcagattggagggaataataccggcattagaagcg
tctcacgcgctcgcgttcctcgacaaactcgtgcctactcttcgtgatggagccaaggtg
gtagtgaactgcagtggccgtggtgacaaagatttagatactctcatccaacgaggcatg
ccttcttctttttgttga

DBGET integrated database retrieval system