KEGG   Arabidopsis thaliana (thale cress): AT5G35600Help
Entry
AT5G35600         CDS       T00041                                 

Gene name
HDA7
Definition
histone deacetylase7
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 409 aa AA seqDB search
MASLADGGKRRVSYFYEPMIGDYYYGVNQPTKPQRIRVTHNLILSYNLHRHMEINHPDLA
DASDFEKFHSLEYINFLKSVTPETVTDPHPSVSENLKRFNVDVDWDGPVFHNLFDYCRAY
AGGSISAAAKLNRQEADIAINWAGGMHHVKKDKASGFGYVNDVVLAILELLKSFKRVLYI
EIGFPHGDEVEEAFKDTDRVMTVSFHKVGDTGDISDYGEGKGQYYSLNAPLKDGLDDFSL
RGLFIPVIHRAMEIYEPEVIVLQCGADSLAGDPFGTFNLSIKGHGDCLQYVRSFNVPLMI
LGGGGYTLPNVARCWCYETAIAVGEQLDNDLPGNDYMKYFRPDYKLHILPTNRQNLNTRL
DIITMRETLLAQLSLVMHAPSVPFQDTPSSSQATEAAEVDMEKRNDPRI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcttagccgacggaggaaaacgccgcgtcagttacttctacgagccaatgatc
ggcgactactactacggcgttaaccagccaacgaaacctcaacgaatccgtgtcactcac
aacctcatcctcagctataacctccaccgccacatggaaatcaaccacccagacctcgcc
gatgcttccgatttcgaaaaattccactcgctggagtatatcaacttcctcaaatccgtc
acgccggaaaccgtaaccgatcctcatccttccgtctctgaaaacctcaagcgcttcaac
gtagatgtggattgggacggtcctgtcttccataacctcttcgattattgtcgtgcttac
gctggtggttctattagcgccgccgcgaaattgaaccgtcaagaagccgatattgccata
aactgggccggtggtatgcaccatgtgaagaaagataaagcttctggctttggttatgtc
aatgacgttgtgcttgcgattctcgagttactaaaatctttcaagagagttctctacata
gaaattggttttcctcatggtgatgaagtggaagaagcatttaaggatactgatagagta
atgactgtttctttccacaaagttggggacaccggagacataagtgactatggggaaggg
aaaggacaatactattcactcaatgcaccattaaaggatggtttggatgattttagtctt
cgtggtttgttcattcctgttatccacagagctatggaaatctatgagccagaagtaatt
gttcttcagtgtggtgctgattctttagctggtgatccgtttggtacattcaacttgtct
atcaagggtcatggtgattgcttacagtacgtaagatcttttaatgttcctctcatgatc
ttggggggtggaggttatactcttccaaatgttgctcgttgctggtgctatgagacggcg
attgcggttggagaacaacttgacaatgatctcccaggcaatgattacatgaagtatttt
cgtccagattacaagcttcatatattgccaaccaacaggcagaatttaaacacacgatta
gatattataacaatgagggaaactttactagcgcaactttctctagtaatgcacgcacct
agtgtaccgtttcaagacactccatcaagcagtcaagccactgaagcggcggaagtggac
atggagaagagaaatgatccacgcatttga

DBGET integrated database retrieval system