KEGG   Arabidopsis thaliana (thale cress): AT5G35630Help
Entry
AT5G35630         CDS       T00041                                 

Gene name
GS2
Definition
(RefSeq) glutamine synthetase 2
  KO
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT5G35630 (GS2)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT5G35630 (GS2)
  Energy metabolism
   00910 Nitrogen metabolism
    AT5G35630 (GS2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT5G35630 (GS2)
   00220 Arginine biosynthesis
    AT5G35630 (GS2)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     AT5G35630 (GS2)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT5G35630 (GS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 430 aa AA seqDB search
MAQILAASPTCQMRVPKHSSVIASSSKLWSSVVLKQKKQSNNKVRGFRVLALQSDNSTVN
RVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSSTGQ
APGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAKAAEIFSNKKVSGE
VPWFGIEQEYTLLQQNVKWPLGWPVGAFPGPQGPYYCGVGADKIWGRDISDAHYKACLYA
GINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQAGVVLTLDPKPIEGD
WNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASID
QFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEA
LAAQKLSLNV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcttagcagcttctccaacatgtcagatgagagtgcctaaacactcatca
gtcattgcatcatcatccaagttatggagctctgttgtgttgaaacagaagaagcagagc
aacaacaaagtcagaggctttagagttcttgctctccaatctgataacagtactgtcaat
agagttgagactcttctcaatttagacaccaaaccttactctgacaggatcattgctgaa
tacatttggatcggaggatctggaattgaccttagaagcaagtcaaggactatcgaaaag
ccggtggaggatccttctgagctacctaagtggaactatgatggttcgagtaccggtcaa
gcacctggtgaagatagtgaagtgattctatacccgcaagctatcttcagagatcctttc
cgtggaggcaataacatcttggttatctgtgatacttggacaccagctggtgagccaatt
ccaacaaacaaacgtgctaaagctgctgagatcttcagtaacaagaaggtctctggcgag
gttccatggttcggcattgaacaagagtacactttacttcagcaaaacgtcaaatggcct
ttaggttggcctgttggagcgttccctggtcctcagggtccttactactgtggagttgga
gctgacaagatttgggggcgtgacatttcagatgctcattacaaagcttgtttatatgct
ggaattaacattagtggtactaatggtgaagttatgcctggacagtgggagttccaagtt
ggcccgagcgtaggaattgatgcaggtgatcatgtttggtgtgctagataccttcttgag
agaatcacagaacaagctggtgttgtcctaacacttgatcccaaaccgatagagggtgac
tggaacggtgctggttgccacaccaattacagtaccaagagcatgagagaggaaggagga
tttgaagtgatcaagaaggctatcttgaacctctcgcttcgccacaaggagcacatcagt
gcctacggtgaaggaaacgagagaaggttgaccggaaagcacgagacagctagtattgac
cagttctcatggggcgtggctaaccgtggatgctctattcgtgtgggacgtgacaccgag
gcgaaaggaaaaggttacttagaagatcgccgtccagcatctaacatggacccatacatt
gtgacctcacttttggcagagaccacactcctgtgggagccaactcttgaggctgaagcc
cttgcagctcaaaagctttctttgaatgtttaa

DBGET integrated database retrieval system