KEGG   Arabidopsis thaliana (thale cress): AT5G35750Help
Entry
AT5G35750         CDS       T00041                                 

Gene name
HK2
Definition
(RefSeq) histidine kinase 2
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT5G35750 (HK2)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AT5G35750 (HK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA DUF5324
Motif
Other DBs
NCBI-GeneID: 833552
NCBI-ProteinID: NP_568532
MIPS: AT5G35750.1
TAIR: AT5G35750
Araport: AT5G35750
UniProt: Q9C5U2
Position
5
AA seq 1176 aa AA seqDB search
MSITCELLNLTSKKAKKSSSSDKKWLKKPLFFLILCGSLVIVLVMFLRLGRSQKEETDSC
NGEEKVLYRHQNVTRSEIHDLVSLFSDSDQVTSFECHKESSPGMWTNYGITCSLSVRSDK
QETRGLPWNLGLGHSISSTSCMCGNLEPILQQPENLEEENHEEGLEQGLSSYLRNAWWCL
ILGVLVCHKIYVSHSKARGERKEKVHLQEALAPKKQQQRAQTSSRGAGRWRKNILLLGIL
GGVSFSVWWFWDTNEEIIMKRRETLANMCDERARVLQDQFNVSLNHVHALSILVSTFHHG
KIPSAIDQRTFEEYTERTNFERPLTSGVAYALKVPHSEREKFEKEHGWAIKKMETEDQTV
VQDCVPENFDPAPIQDEYAPVIFAQETVSHIVSVDMMSGEEDRENILRARASGKGVLTSP
FKLLKSNHLGVVLTFAVYDTSLPPDATEEQRVEATIGYLGASYDMPSLVEKLLHQLASKQ
TIAVDVYDTTNTSGLIKMYGSEIGDISEQHISSLDFGDPSRNHEMHCRFKHKLPIPWTAI
TPSILVLVITFLVGYILYEAINRIATVEEDCQKMRELKARAEAADIAKSQFLATVSHEIR
TPMNGVLGMLKMLMDTDLDAKQMDYAQTAHGSGKDLTSLINEVLDQAKIESGRLELENVP
FDMRFILDNVSSLLSGKANEKGIELAVYVSSQVPDVVVGDPSRFRQIITNLVGNSIKFTQ
ERGHIFISVHLADEVKEPLTIEDAVLKQRLALGCSESGETVSGFPAVNAWGSWKNFKTCY
STESQNSDQIKLLVTVEDTGVGIPVDAQGRIFTPFMQADSSTSRTYGGTGIGLSISKRLV
ELMQGEMGFVSEPGIGSTFSFTGVFGKAETNTSITKLERFDLAIQEFTGLRALVIDNRNI
RAEVTRYELRRLGISADIVSSLRMACTCCISKLENLAMILIDKDAWNKEEFSVLDELFTR
SKVTFTRVPKIFLLATSATLTERSEMKSTGLIDEVVIKPLRMSVLICCLQETLVNGKKRQ
PNRQRRNLGHLLREKQILVVDDNLVNRRVAEGALKKYGAIVTCVESGKAALAMLKPPHNF
DACFMDLQMPEMDGFEATRRVRELEREINKKIASGEVSAEMFCKFSSWHVPILAMTADVI
QATHEECMKCGMDGYVSKPFEEEVLYTAVARFFEPC
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgtctataacttgtgagctcttgaatcttacttcaaagaaagctaagaagtcgtcgagc
agtgacaagaaatggctaaagaagcctctcttcttcctgattttgtgtggctctttggta
attgttttggttatgttcttacggttaggtagaagtcagaaggaggagacagattcttgt
aatggagaagagaaagtgttgtatagacatcaaaatgtcacaagaagtgagattcatgat
ttggtctctttgttctctgattcagatcaggtaacatcctttgaatgtcataaggaatca
agccctggaatgtggacaaactatggtattacatgttccctgagtgtgcgttctgataaa
caagagactagagggcttccctggaatcttggcttaggacattctatctcatcaacatct
tgtatgtgtggtaatcttgaaccgattttacagcaacctgaaaaccttgaggaagaaaac
catgaagaagggctggagcagggtttgtcatcgtatttaagaaatgcatggtggtgtcta
atccttggtgtgttagtgtgccataagatttatgtatctcattctaaagcacgaggtgag
aggaaagagaaagtacatctgcaagaggctttagctccaaagaagcagcaacaacgtgct
cagacttcttctagaggggctggaagatggaggaagaatatccttctccttggtatttta
ggaggagtttccttctctgtttggtggttttgggacactaatgaggagatcataatgaaa
aggagggagactttggcaaacatgtgtgacgaacgagcacgtgttttacaagatcagttc
aatgttagcttgaaccatgttcatgccttgtctattcttgtatctacatttcatcatggt
aaaatcccatctgccattgatcagagaacatttgaagaatatactgagagaacaaacttt
gagaggccacttactagtggtgtagcgtatgctttgaaagtcccacactcagaaagagag
aaatttgaaaaggagcatggatgggcaataaagaaaatggaaactgaggaccagacagtt
gtacaagattgtgttcctgaaaactttgatcccgcaccgattcaagacgaatacgcgcca
gttatatttgctcaagaaactgtttcccatattgtatcggtcgacatgatgtctggagaa
gaagaccgtgaaaacatcttacgggcaagggcatcaggaaaaggagtgttaacatctcca
tttaagcttcttaagtcaaatcatcttggtgttgtgttgacctttgctgtctatgacacg
agcctaccgcctgatgctacagaagaacagcgtgttgaagcaactattgggtaccttggt
gcatcatatgatatgccatcgctggtggagaaacttcttcaccaacttgccagcaaacag
acaattgctgtggatgtttacgacacaactaacacttcaggtctaataaaaatgtatggc
tcagaaattggggatataagtgagcagcatataagtagccttgattttggtgatccatca
aggaaccatgagatgcattgcaggtttaagcataaacttcccattccctggacagcgata
acaccgtcgatcttagttctggttattacttttcttgttggttatattttatatgaagcc
atcaaccgaattgcgacagttgaagaggattgtcagaagatgagggaactcaaagctcgt
gctgaggccgctgacattgcaaagtcacagttcctagcaactgtttctcatgagatacgg
actccgatgaatggagttttaggaatgctgaaaatgctgatggacaccgatcttgatgcg
aagcagatggactatgcgcaaactgctcatggcagtgggaaggatcttacatcactaata
aatgaggttcttgatcaggcaaagattgaatccggaaggctcgagcttgaaaatgtgcct
tttgatatgcgttttattcttgataatgtttcatctctcctctctggcaaggcaaatgaa
aaaggaattgagttggccgtttatgtttctagtcaagttcctgatgttgtagtcggtgat
ccgagtcggttccggcagatcattacaaacctggttggaaactcaatcaaattcacacag
gaaaggggacacatatttatctcagtgcaccttgcagatgaggtaaaggagcctcttact
attgaagacgcagtgctaaaacagcgactagctttaggatgcagcgagtccggtgagaca
gttagcgggtttcctgcggtaaatgcatggggaagctggaagaatttcaagacatgttac
agtactgagagtcagaattctgatcaaatcaaattgctagttacagtggaggacactgga
gttggcatacctgtggatgcacaaggccgaatcttcacaccttttatgcaagccgacagt
tccacatcgcggacttatggtggaactggcataggtttgagtataagcaaacgtttggtt
gaactcatgcaaggagagatggggtttgtgagtgagcccgggataggcagtactttttca
tttactggagttttcgggaaagcagaaacaaatacgtcgattactaagctggaacgattc
gatctagctattcaggagtttacaggattgagagcattagttattgataacagaaacatt
agagcagaggtcaccaggtacgaacttcggagactgggaatatctgcagacattgtttca
agtctgagaatggcatgcacttgttgtatcagcaaattagaaaatttggctatgattcta
atagacaaagacgcctggaacaaggaagaattttcagtacttgacgagttgtttacccga
agcaaagtaacctttacaagagtcccaaagatttttcttttggcaacttctgcaactctt
actgagcgcagtgagatgaagtctactggtctcatcgatgaggtggtgataaagcctctt
cggatgagtgtcttaatatgttgcttgcaagaaacccttgtcaatggcaagaagaggcaa
ccgaacagacagcgaagaaatcttggacacttgctaagagaaaaacagattctggttgtg
gatgataatcttgtgaacagacgagttgcagaaggtgcacttaagaaatatggagctatt
gttacatgcgttgagagtggcaaagctgcattggcaatgcttaagccgcctcataacttc
gatgcttgcttcatggatctccagatgcctgaaatggatggatttgaagcgacaaggaga
gtccgtgagctggagagggaaatcaataagaaaatagcttctggagaagtttcagctgaa
atgttctgtaaatttagtagttggcacgtcccgatattagcaatgacagcagatgttatt
caggctactcatgaagaatgcatgaaatgtggaatggatggttatgtatcaaaaccgttt
gaagaggaagtgctctacacagcggtagcaagattctttgaaccttgttaa

DBGET integrated database retrieval system