KEGG   Arabidopsis thaliana (thale cress): AT5G36880Help
Entry
AT5G36880         CDS       T00041                                 

Gene name
ACS
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT5G36880 (ACS)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT5G36880 (ACS)
   00620 Pyruvate metabolism
    AT5G36880 (ACS)
   00640 Propanoate metabolism
    AT5G36880 (ACS)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AT5G36880 (ACS)
Lipid biosynthesis proteins [BR:ath01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AT5G36880 (ACS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 743 aa AA seqDB search
MKIGSPSSPILSVVSSSGSLDPKISGSLGSRILPATQRSSPSENLLLHRKMSSNSLRHVE
SMSQLPSGAGKISQLNAVVLGESLASEENDLVFPSKEFSGQALVSSPQQYMEMHKRSMDD
PAAFWSDIASEFYWKQKWGDQVFSENLDVRKGPISIEWFKGGITNICYNCLDKNVEAGLG
DKTAIHWEGNELGVDASLTYSELLQRVCQLANYLKDNGVKKGDAVVIYLPMLMELPIAML
ACARIGAVHSVVFAGFSADSLAQRIVDCKPNVILTCNAVKRGPKTINLKAIVDAALDQSS
KDGVSVGICLTYDNSLATTRENTKWQNGRDVWWQDVISQYPTSCEVEWVDAEDPLFLLYT
SGSTGKPKGVLHTTGGYMIYTATTFKYAFDYKSTDVYWCTADCGWITGHSYVTYGPMLNG
ATVVVFEGAPNYPDPGRCWDIVDKYKVSIFYTAPTLVRSLMRDDDKFVTRHSRKSLRVLG
SVGEPINPSAWRWFFNVVGDSRCPISDTWWQTETGGFMITPLPGAWPQKPGSATFPFFGV
QPVIVDEKGNEIEGECSGYLCVKGSWPGAFRTLFGDHERYETTYFKPFAGYYFSGDGCSR
DKDGYYWLTGRVDDVINVSGHRIGTAEVESALVLHPQCAEAAVVGIEHEVKGQGIYAFVT
LLEGVPYSEELRKSLVLMVRNQIGAFAAPDRIHWAPGLPKTRSGKIMRRILRKIASRQLE
ELGDTSTLADPSVVDQLIALADV
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggatctccttcttccccgattctcagcgttgtctccagctcaggctcattg
gatccgaaaattagtggatcacttggatctcgaatccttccggctactcaaagatcatcc
ccatcggagaatcttctcctccataggaaaatgtcgtctaattccctgaggcatgtcgag
tccatgtcccagctaccctcaggtgccggaaagatctctcaattaaacgccgtcgtgtta
ggagaatcccttgcatcggaggagaatgatctcgtctttcccagcaaggaattctccggc
caggctcttgtttcctcccctcaacagtacatggaaatgcataagaggtcgatggatgac
cctgctgctttttggtctgatattgcgtctgagttttactggaagcagaaatggggtgac
caagtgttttccgagaatctcgatgtcaggaagggtcctattagcatcgagtggtttaaa
gggggaatcaccaatatttgctacaactgtttggacaaaaacgttgaagctggtttgggt
gataaaacagccatacactgggaaggaaatgaacttggggtagatgcttccttaacttat
tctgagttgctccaacgagtttgccagcttgctaattacttgaaagataatggagtgaag
aagggtgatgctgttgtaatttatttacctatgttgatggaacttcccatcgctatgctt
gcatgtgcaaggatcggagctgttcattcggtcgtttttgctggattttctgcggactct
cttgcccaaagaatcgttgattgcaagccaaatgtaatactgacttgcaatgctgttaaa
agaggccctaagaccataaaccttaaagctattgttgatgctgcacttgaccaatcttct
aaagatggagtctctgtaggcatatgcttgacctatgacaactcattagcgacaacaagg
gaaaacactaaatggcagaatggaagagatgtgtggtggcaggatgttatttctcaatat
ccaacatcgtgtgaggtggaatgggttgatgcagaagatcccctgtttttgctctacacc
agtggaagtactgggaagccaaagggtgtcctacacacaactggagggtatatgatctac
actgctacaacgttcaaatatgcatttgactacaaatcaacagatgtatactggtgtaca
gcagattgtggttggataactggccatagctatgttacttatggaccaatgcttaatgga
gccactgttgttgtctttgagggggctccaaactaccctgaccctggacgctgttgggat
attgttgacaaatacaaggtttcaatattttatactgccccaacattggtgaggtctctc
atgcgcgatgacgataagtttgtaacacgtcactcgcgcaaatcgctgcgggtccttgga
agtgttggtgagcccatcaatcctagtgcctggagatggttcttcaatgtagtcggtgat
tcaaggtgtcccatttcagatacgtggtggcaaactgaaactggtggcttcatgataacc
ccattgccaggtgcttggccccagaaacctggttcagccactttccctttctttggtgtt
cagcctgtcatagttgatgaaaagggcaatgaaatcgaaggcgagtgtagtggttatctt
tgtgtcaaaggttcatggcccggggcgtttcgaactctgtttggggatcatgaaagatac
gaaaccacatactttaaaccttttgccggatattatttcagtggtgatggttgcagcaga
gacaaggatggttactactggcttacagggagggttgatgatgttatcaacgtcagtggc
catcgaatcggaactgctgaagtagaatctgctctggttttacaccctcaatgtgcagaa
gcagctgttgtaggcatagaacatgaggtaaaaggtcagggaatttatgcgtttgtcact
cttctggaaggtgttccttacagcgaggagcttcgtaaaagcctagtactaatggtccga
aatcagattggggcttttgcagcaccggacagaatacattgggcaccagggttgccaaag
acgagaagcggaaagataatgaggagaatcttgagaaagattgcttcgaggcaattagaa
gaactcggagatactagcacactcgcggatcctagtgtagttgatcagcttattgcactt
gccgatgtgtga

DBGET integrated database retrieval system