KEGG   Arabidopsis thaliana (thale cress): AT5G36890Help
Entry
AT5G36890         CDS       T00041                                 

Gene name
BGLU42
Definition
(RefSeq) beta glucosidase 42
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00460  Cyanoamino acid metabolism
ath00500  Starch and sucrose metabolism
ath00940  Phenylpropanoid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT5G36890 (BGLU42)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AT5G36890 (BGLU42)
  Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT5G36890 (BGLU42)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AT5G36890 (BGLU42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 833656
NCBI-ProteinID: NP_198505
MIPS: AT5G36890.1
TAIR: AT5G36890
Araport: AT5G36890
UniProt: Q9FIW4
Position
5
AA seq 490 aa AA seqDB search
MAQKLNLLNLAVPPVTHRSNFPSTFTFGVATSAYQIEGGWNEGKKGPSIWDKFTHIEGKI
LDGSNGDVAVDHYHRYKEDVDLIGQLGFGAYRFSISWSRIFPDGLGTEVNEEGIAFYNDL
INTLLEKGIQPYVTLYHWDLPSHLQEAIGGWTNRKIVDYFGLYADACFANFGDRVKHWIT
LNEPLQTSVNGHCIGIFAPGRNEKPLIEPYLVSHHQVLAHATAVSIYRSKYKESQGGQIG
LSVDCEWAEPNSEKPEDKVAADRRIDFQLGWFLDPLFFGDYPASMRQKLGDNLPRFTPEE
KEFMLQNSWDFLGLNHYTSRLISHVSNKEAESNFYQAQELERIVELENGDLIGERAASDW
LYAVPWGIRKTLNYMSKKYNHPPIFITENGMDDEDDGSASIHDMLDDKRRVDYFKSYLAN
VSQAIEDGVDIKGYFAWSLLDNFEWAQGYTKRFGLVYVDYKNGLTRHPKSSAYWFMKFLK
GDEENKGKKE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaagcttaacttgcttaatctcgccgtccctccggtcacccaccgctctaac
ttcccttccaccttcaccttcggcgtcgccacttccgcttaccagattgaaggaggttgg
aatgaaggtaaaaagggaccaagtatatgggataagttcactcatatcgaagggaagatt
cttgatggaagtaacggcgatgttgctgtggatcattaccatagatacaaggaagatgtt
gatcttataggacaattaggattcggtgcttacagattttctatatcttggtctcgaatt
ttccctgatggcctgggaactgaagtcaatgaagaaggcattgctttctacaacgatctt
attaatacacttcttgaaaaaggtattcagccgtatgtaactctgtaccattgggatctc
ccatcacatctccaggaagcaatcggaggttggacaaataggaaaattgtcgattatttt
ggcctctatgcagatgcttgttttgccaattttggtgatagagtgaagcactggatcaca
ttaaatgaacctcttcagacctcggtgaatggacactgtattggtatatttgcacctgga
agaaatgagaagcccttgatcgaaccatatttggtctcacatcatcaggttctggcccat
gcaactgctgtatccatatatagaagcaagtacaaggaaagtcaaggtggacaaatcggt
ttgtcagttgattgtgaatgggcagagccaaactctgagaaaccagaagacaaggttgct
gcggataggcgaattgactttcaacttggatggttcttggatcctttgttttttggagac
tatcctgcaagtatgcgccagaaacttggagacaatcttcctagatttactccggaagaa
aaggagtttatgcttcaaaactcatgggacttccttggcctgaaccactatacgtcgagg
ttgatttctcatgtctcaaacaaagaagctgagagtaacttttaccaagcacaagaattg
gagaggattgttgaactggaaaatggagatttgataggcgaaagggctgcttcggattgg
ctttatgctgtgccttggggaatccgaaagacattgaattacatgagcaaaaaatataac
caccctccaatatttatcactgaaaatggtatggatgatgaagatgatggatcggcctct
attcatgatatgcttgacgataaacgtagagttgactatttcaagagttaccttgccaac
gtctcccaggctattgaagacggagtggacataaagggatactttgcgtggtcgctgctg
gacaacttcgagtgggcgcaagggtacaccaagagatttggtttggtatatgtagactac
aagaacggtttaacccgtcacccaaaatcatctgcttactggttcatgaaatttctgaaa
ggtgatgaagaaaacaaaggtaagaaggaatga

DBGET integrated database retrieval system