KEGG   Arabidopsis thaliana (thale cress): AT5G37260Help
Entry
AT5G37260         CDS       T00041                                 

Gene name
RVE2
Definition
MYB family transcription factor Circadian 1
Organism
ath  Arabidopsis thaliana (thale cress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 287 aa AA seqDB search
MAMQERCESLCSDELISSSDAFYLKTRKPYTITKQREKWTEAEHEKFVEALKLYGRAWRR
IEEHVGTKTAVQIRSHAQKFFTKVARDFGVSSESIEIPPPRPKRKPMHPYPRKLVIPDAK
EMVYAELTGSKLIQDEDNRSPTSVLSAHGSDGLGSIGSNSPNSSSAELSSHTEESLSLEA
ETKQSLKLFGKTFVVGDYNSSMSCDDSEDGKKKLYSETQSLQCSSSTSENAETEVVVSEF
KRSERSAFSQLKSSVTEMNNMRGFMPYKKRVKVEENIDNVKLSYPLW
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcaggaacgttgtgagagtttatgttctgatgaacttatatcttcctcagat
gccttttacctcaagacaagaaagccttataccatcactaaacaaagagagaaatggaca
gaagcagagcatgagaagtttgtagaagcattgaaactctatggcagagcttggagacga
atcgaagaacatgttggaacaaaaactgcagttcagattcgaagccatgcgcagaagttc
tttactaaggttgctcgcgattttggtgttagctctgagtccattgagatcccgcctcca
aggccaaagagaaagccgatgcatccttaccctagaaagcttgtgattcctgatgcaaaa
gagatggtatacgctgaactaaccggatccaagctgattcaggatgaagataaccgatct
ccaacatcggttttatcagctcatggctcagatggattaggttccattggttcaaattca
cctaactcttcttcagctgagttatcatctcacacagaggaatcattgtctctagaagca
gagaccaaacagagccttaagctctttggaaaaacttttgtagttggtgattacaactct
tcaatgagttgtgatgattctgaagatggcaagaagaagctatactcagaaacacagtct
cttcaatgttcttcttctacttcagaaaacgctgaaacagaagtggtagtgtcggagttc
aaaagaagtgagagatcagctttctctcagttaaaatcgtcggtgactgagatgaacaac
atgagagggttcatgccttacaaaaagagagtaaaggtggaagaaaacattgacaatgta
aaattatcatatcctttgtggtga

DBGET integrated database retrieval system