KEGG   Arabidopsis thaliana (thale cress): AT5G37260Help
Entry
AT5G37260         CDS       T00041                                 

Gene name
RVE2
Definition
(RefSeq) Homeodomain-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 833700
NCBI-ProteinID: NP_198542
MIPS: AT5G37260.1
TAIR: AT5G37260
Araport: AT5G37260
UniProt: F4K5X6
Position
5
AA seq 287 aa AA seqDB search
MAMQERCESLCSDELISSSDAFYLKTRKPYTITKQREKWTEAEHEKFVEALKLYGRAWRR
IEEHVGTKTAVQIRSHAQKFFTKVARDFGVSSESIEIPPPRPKRKPMHPYPRKLVIPDAK
EMVYAELTGSKLIQDEDNRSPTSVLSAHGSDGLGSIGSNSPNSSSAELSSHTEESLSLEA
ETKQSLKLFGKTFVVGDYNSSMSCDDSEDGKKKLYSETQSLQCSSSTSENAETEVVVSEF
KRSERSAFSQLKSSVTEMNNMRGFMPYKKRVKVEENIDNVKLSYPLW
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcaggaacgttgtgagagtttatgttctgatgaacttatatcttcctcagat
gccttttacctcaagacaagaaagccttataccatcactaaacaaagagagaaatggaca
gaagcagagcatgagaagtttgtagaagcattgaaactctatggcagagcttggagacga
atcgaagaacatgttggaacaaaaactgcagttcagattcgaagccatgcgcagaagttc
tttactaaggttgctcgcgattttggtgttagctctgagtccattgagatcccgcctcca
aggccaaagagaaagccgatgcatccttaccctagaaagcttgtgattcctgatgcaaaa
gagatggtatacgctgaactaaccggatccaagctgattcaggatgaagataaccgatct
ccaacatcggttttatcagctcatggctcagatggattaggttccattggttcaaattca
cctaactcttcttcagctgagttatcatctcacacagaggaatcattgtctctagaagca
gagaccaaacagagccttaagctctttggaaaaacttttgtagttggtgattacaactct
tcaatgagttgtgatgattctgaagatggcaagaagaagctatactcagaaacacagtct
cttcaatgttcttcttctacttcagaaaacgctgaaacagaagtggtagtgtcggagttc
aaaagaagtgagagatcagctttctctcagttaaaatcgtcggtgactgagatgaacaac
atgagagggttcatgccttacaaaaagagagtaaaggtggaagaaaacattgacaatgta
aaattatcatatcctttgtggtga

DBGET integrated database retrieval system