KEGG   Arabidopsis thaliana (thale cress): AT5G37475Help
Entry
AT5G37475         CDS       T00041                                 

Definition
translation initiation factor eIF3 subunit
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ath03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 225 aa AA seqDB search
MDDWEAEDFQPLPSKVELKSNWDDEDVDENDIKDSWEEEDVSAPPPIVKPASEKAPKKPA
VKAVEKKVKTVEAPKGTSREEPLDPIAEKLRMQRLVEEADYQSTAELFGVKTEEKSVDML
IPKSESDFLDYAELISQRLVPFEKSFHYIGLLKAVMRLSVANMKAADVKDVASSITAIAN
EKLKAEKEAAAGKKKSGKKKQLHVDKPDDDLVSGPYDAMDDDDFM
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggatgattgggaggccgaggactttcaaccacttccctcaaaagttgaactgaaaagt
aactgggatgatgaggatgtggatgagaatgatatcaaggactcgtgggaggaggaagat
gtatctgctccgccacctatagtaaagcctgcttctgagaaggctccaaagaaaccagca
gtaaaagctgttgaaaagaaggttaaaactgttgaagctccgaaaggaacatcaagggaa
gaacctctagatcctattgctgagaaacttcgcatgcagaggcttgtagaggaagctgat
taccaatcaactgctgaactctttggagtaaagactgaagagaaaagcgtcgatatgtta
attccgaagtctgaaagcgatttcttggattatgctgagttgatatctcagagacttgta
ccatttgagaaaagctttcactatatcgggctactcaaagcagtgatgagactttctgtg
gctaatatgaaagcagcagatgttaaagacgttgcttcgtccattacagctatagcaaat
gaaaaattgaaggcggagaaagaagctgctgctggcaaaaagaagtcaggtaagaagaaa
caacttcatgttgataagcctgatgatgatcttgtttcgggtccttatgatgccatggac
gatgatgatttcatgtga

DBGET integrated database retrieval system