KEGG   Arabidopsis thaliana (thale cress): AT5G37475Help
Entry
AT5G37475         CDS       T00041                                 

Definition
translation initiation factor eIF3 subunit
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT5G37475
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AT5G37475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 225 aa AA seqDB search
MDDWEAEDFQPLPSKVELKSNWDDEDVDENDIKDSWEEEDVSAPPPIVKPASEKAPKKPA
VKAVEKKVKTVEAPKGTSREEPLDPIAEKLRMQRLVEEADYQSTAELFGVKTEEKSVDML
IPKSESDFLDYAELISQRLVPFEKSFHYIGLLKAVMRLSVANMKAADVKDVASSITAIAN
EKLKAEKEAAAGKKKSGKKKQLHVDKPDDDLVSGPYDAMDDDDFM
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggatgattgggaggccgaggactttcaaccacttccctcaaaagttgaactgaaaagt
aactgggatgatgaggatgtggatgagaatgatatcaaggactcgtgggaggaggaagat
gtatctgctccgccacctatagtaaagcctgcttctgagaaggctccaaagaaaccagca
gtaaaagctgttgaaaagaaggttaaaactgttgaagctccgaaaggaacatcaagggaa
gaacctctagatcctattgctgagaaacttcgcatgcagaggcttgtagaggaagctgat
taccaatcaactgctgaactctttggagtaaagactgaagagaaaagcgtcgatatgtta
attccgaagtctgaaagcgatttcttggattatgctgagttgatatctcagagacttgta
ccatttgagaaaagctttcactatatcgggctactcaaagcagtgatgagactttctgtg
gctaatatgaaagcagcagatgttaaagacgttgcttcgtccattacagctatagcaaat
gaaaaattgaaggcggagaaagaagctgctgctggcaaaaagaagtcaggtaagaagaaa
caacttcatgttgataagcctgatgatgatcttgtttcgggtccttatgatgccatggac
gatgatgatttcatgtga

DBGET integrated database retrieval system