KEGG   Arabidopsis thaliana (thale cress): AT5G38530Help
Entry
AT5G38530         CDS       T00041                                 

Gene name
TSBtype2
Definition
tryptophan synthase beta chain
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AT5G38530 (TSBtype2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT5G38530 (TSBtype2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT5G38530 (TSBtype2)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AT5G38530 (TSBtype2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 506 aa AA seqDB search
MASQLLLPPNQFTKSVSPQVFITGDCQGFSDLTLKRKSNQATRVSNGSSLRVKAALRSTH
NKSVVEIPKQWYNLVADLSVKPPPPLHPKTFEPIKPEDLAHLFPNELIKQEATQERFIDI
PEEVLEIYKLWRPTPLIRAKRLEKLLQTPARIYFKYEGGSPAGSHKPNTAVPQAYYNAKE
GVKNVVTETGAGQWGSSLAFASSLFGLDCEVWQVANSYHTKPYRRLMMQTWGAKVHPSPS
DLTEAGRRILESDPSSPGSLGIAISEAVEVAARNEDTKYCLGSVLNHVLLHQTIIGEECI
QQMENFGETPDLIIGCTGGGSNFAGLSFPFIREKLKGKINPVIRAVEPSACPSLTKGVYA
YDFGDTAGLTPLMKMHTLGHDFIPDPIHAGGLRYHGMAPLISHVYEQGFMEAISIPQIEC
FQGAIQFARTEGIIPAPEPTHAIAATIREALRCKETGEAKVILMAMCGHGHFDLTSYDKY
LKGELVDLSFSEEKIRESLSKVPHVV
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcaattgcttttacctccaaaccaattcactaaatcagtctcacctcaagtt
ttcattactggtgattgtcaaggatttagtgacttaactctgaaaagaaaatcaaaccaa
gctacaagagtttcaaatggatctagcttaagagtaaaagcagctttgagatctactcac
aacaaatcagtggttgagattccaaaacaatggtataatcttgttgctgatctttcagtc
aagcctcctccaccgttgcatccaaagactttcgaaccgataaaacccgaagatttggct
catcttttccccaatgagttgattaaacaagaagctacacaagagaggtttattgatatc
cctgaggaagttcttgaaatctataagctttggcgtccaactcctctaatcagagcaaag
agattagagaagcttcttcaaacaccggcaaggatttacttcaagtatgaaggtggtagc
ccagctggttcacacaaaccaaacacagcggttccacaagcttattacaatgcgaaagaa
ggcgtcaagaacgttgtgacggaaaccggtgctggtcaatggggaagttctttagccttt
gcttctagtctatttggtctcgactgcgaagtatggcaagtagccaactcttaccataca
aagccatatcgccggttaatgatgcaaacttggggtgcaaaggttcatccgtcgccatcg
gatctcactgaggcgggtagaagaatcctcgaatccgatccatcaagtccgggaagttta
ggcattgcgatatcagaagcggttgaagttgcagcgagaaacgaggatacaaaatactgc
ctagggagtgtattgaaccatgtgttgttacaccaaacaattattggagaagaatgcatt
caacaaatggagaattttggtgaaacacctgacctgatcatagggtgtactggtggagga
tcaaattttgctggtttgagttttccttttatccgggagaaactcaaaggcaaaatcaac
cctgttataagagcggttgagccatctgcttgtccttccttgaccaaaggggtttatgct
tatgattttggcgatacggctggattgactcctttgatgaagatgcatactttgggacat
gacttcattcctgatcctatccatgccggtggattaaggtaccatgggatggcaccattg
atctcacatgtttatgaacaaggattcatggaagcaatttcaattcctcaaattgagtgt
ttccaaggtgctattcagtttgcaagaacagaagggatcatacccgcaccagaaccgacc
cacgccattgctgcaaccataagagaggctctccgatgtaaagagacgggagaagcaaaa
gtgatactaatggcgatgtgtggacatggccatttcgaccttacttcttacgacaagtat
ttaaaaggcgagttggtggatttatcattcagcgaagagaagatacgagagtctttgtcc
aaggttcctcatgttgtttaa

DBGET integrated database retrieval system