KEGG   Arabidopsis thaliana (thale cress): AT5G40120Help
Entry
AT5G40120         CDS       T00041                                 

Gene name
AGL76
Definition
(RefSeq) AGAMOUS-like 76
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 385 aa AA seqDB search
MTMRSLPFSSSSYSLASTSLSNRLETIFKKASELCTLCDIEACVIYYGPDGELKTWPKEK
EKVRDIALRYSQLNEALRSKKSVNLHGFLNKKKKKKKKGLKNPNNKRKTCLKKNVNVLKY
PLADHYPPDQVSQLTQSLKLHVSKFQERLRFLESQKQTKPDHQSLTPSSLNHQTQSLNPR
QFSLFMYNHGDNTLSQISVSASNFNQNYFSALLEQSELKNQLMKQDGYDQNQNMRMGDIT
NNNFQLPYFSKKEAVQESVNYFGMNQLMLKELYGCDQNMCMGNINSNSFQHPCVSKAQHY
SAVEGSVNNQRQSELMQQELCGYEQNMCFTNNNFQVSNKEAVQESVTNFGLMQHELYGCD
QNMSMGNIINNSFQQRLKHRTRICE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgactatgcgatcattacctttttcctcttcttcttattcactcgcttccacaagtttg
agtaacagacttgagactatattcaagaaagcttcagagctttgcactctctgtgatatc
gaagcgtgcgtcatctattacggaccagacggagaacttaagacatggcctaaggagaaa
gagaaagtgagagacattgctctgaggtatagtcaattaaacgaagccttgagaagcaag
aaaagcgttaatcttcatgggttcctgaacaagaagaagaagaagaagaagaagggtttg
aagaatccgaacaataagaggaagacttgtcttaagaagaacgtgaatgttttaaagtat
ccactcgctgatcattaccctcccgaccaagtttctcaactgactcagtccttaaaactc
catgtctctaaattccaagaaaggcttcgatttcttgagtcgcagaaacagacaaaaccg
gatcatcagagtttaacaccatcctctttgaatcatcagacccaatctttgaaccctaga
cagttttcgctgtttatgtataaccatggagacaatactctgtctcagatctcagtctct
gcatcaaatttcaatcagaattatttctcagcgttacttgaacaatctgagttgaagaat
cagttaatgaagcaggatggttatgatcagaatcagaacatgaggatgggtgacatcacc
aacaacaattttcaacttccttacttctcaaagaaagaagcggtacaagaatctgtgaac
tactttgggatgaatcagttgatgctgaaggagttatatggttgtgatcaaaacatgtgt
atgggtaacatcaatagcaacagctttcaacatccttgcgtctcaaaggcacaacattac
tcggcggtagaaggatctgtcaataaccaacgacaatctgagttaatgcagcaggagctt
tgtggttatgagcagaacatgtgctttaccaacaacaattttcaagtctcaaacaaagaa
gcggttcaagaatctgtgactaattttgggttgatgcagcatgaactttatgggtgtgat
caaaacatgtctatgggcaacatcattaacaacagctttcaacagcgtctcaaacacaga
acaagaatctgtgaataa

DBGET integrated database retrieval system