KEGG   Arabidopsis thaliana (thale cress): AT5G40330Help
Entry
AT5G40330         CDS       T00041                                 

Gene name
MYB23
Definition
(RefSeq) transcription factor MYB23
  KO
K09422  
myb proto-oncogene protein, plant
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT5G40330 (MYB23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 219 aa AA seqDB search
MRMTRDGKEHEYKKGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNY
LSPNVNRGNFTDQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGLGD
HSTAVKAACGVESPPSMALITTTSSSHQEISGGKNSTLRFDTLVDESKLKPKSKLVHATP
TDVEVAATVPNLFDTFWVLEDDFELSSLTMMDFTNGYCL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgacaagagatggaaaagaacatgaatacaagaaaggtttatggacagtggaa
gaagacaagatcctcatggattatgtccgaactcatggccagggccactggaaccgcatc
gccaagaaaactgggctcaagagatgtgggaaaagctgtaggttgagatggatgaactac
ttaagccctaatgttaacagaggcaattttactgaccaagaagaagatctcatcatcaga
ctccacaagctcctcggcaacagatggtcgttgatagcgaaaagagttccgggaagaaca
gacaaccaagtaaagaattactggaacacacatctcagcaagaaacttggtctcggagat
cattcaactgccgtcaaagccgcatgcggtgtagagtctccaccgtctatggcccttata
accacaacgtcctcctctcatcaagagatctccggtggaaaaaattcaactctaaggttc
gacactttagttgacgaatccaaactcaaaccaaaatccaaactagtccacgcaacacca
actgacgtagaagttgcagctacggttccaaatctgttcgataccttttgggttcttgaa
gacgacttcgagcttagttcactcactatgatggattttactaatgggtattgcctttga

DBGET integrated database retrieval system