KEGG   Arabidopsis thaliana (thale cress): AT5G42190Help
Entry
AT5G42190         CDS       T00041                                 

Definition
(RefSeq) E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein
  KO
K03094  
S-phase kinase-associated protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-SKP2 complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT5G42190
   04120 Ubiquitin mediated proteolysis
    AT5G42190
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     AT5G42190
   Cul7 complex
     AT5G42190
Chromosome [BR:ath03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     AT5G42190
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     AT5G42190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 171 aa AA seqDB search
MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYC
KRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLN
IKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggtgagaaaaatcactcttaagagttcggatggcgaaaacttcgaaattgac
gaagcggtggcgctagagtcacaaaccatcaaacatatgattgaagatgactgtaccgat
aatggtatccctctccctaatgtcacaagcaagatcctttcgaaggtgattgagtactgt
aagagacatgtcgaagctgctgagaaatccgaaaccacggccgatgctgctgctgctact
actaccaccaccgtcgcgtcgggttctagtgatgaagatctcaagacttgggattctgag
tttatcaaagttgatcagggcactctcttcgatcttatcctggctgctaactacttgaat
atcaagggactgttggacttgacttgccagacagtggctgatatgattaaaggaaaaacc
ccagaagaaatccgtaagacgttcaatatcaagaacgacttcacgccagaggaagaagaa
gaggttcgccgtgagaatcagtgggcgtttgaatga

DBGET integrated database retrieval system