KEGG   Arabidopsis thaliana (thale cress): AT5G42370Help
Entry
AT5G42370         CDS       T00041                                 

Definition
calcineurin-like metallo-phosphoesterase-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ath00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 453 aa AA seqDB search
MNQISFWCLSLLLTVVIAAEETPITRIAFGSCANQSAPQPIWDAINKFDPQLFIWLGDNI
YGDIRRPLTVIGKERTFGPWRNSPRFVPSSEEEMKLRYAKAKANPGYSRIQRKAKVIGTW
DDHDYGLNDAGKEFDRKVINQKLMLDFLNEPLDSPRRKQAGVYASYTYGPPNRKVKVIVL
DTRYHRDPLRSDGSILGDTQWDWLENELSGPRSEITIIGSSVQVISNLSATTGPLFYMES
WGRFPKERKRLFKLIADTKRDGVIFISGDVHFGEITRYDCSVGYPLYDVTSSGLVQSVEK
VVPRPLRSIVRLLFWYTPSTMRVINDNCKFKSCTYGIILNLIPFTFSSDKLWKDLLTSQD
TLEIRDVNGDTVLGTNVSLSELQPGGSNSLKDTTTKGKSQRYCTLEIELPGTTRYRLAVL
IYFTIAVLAMAILGLIIGAVLAITACVYKCKVD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaatctctttctggtgcctttctttactccttacggtggtgattgctgcagaa
gagactcctatcactcgtatagccttcggatcatgcgctaatcaaagtgctccacagccg
atatgggatgcgataaacaagtttgatccgcaactgtttatttggttgggtgataacatc
tacggagatataagaagaccacttacagtcattgggaaagagagaacttttgggccatgg
aggaattcaccgaggtttgtaccttcttcagaggaagaaatgaaactaagatacgctaaa
gccaaagctaatcctggatattctcgtattcagagaaaagctaaggttattggtacatgg
gatgatcatgattacggattgaatgacgctggaaaagagtttgatcgtaaagtcattaac
caaaaacttatgcttgatttcttgaatgagcctcttgatagtcctaggagaaagcaagct
ggtgtttatgcttcttatacttatggtccgcctaatcggaaagttaaggttatagtttta
gatactagatatcatagagaccctttaagaagtgacgggagcatattgggtgatacgcag
tgggactggctcgaaaatgaattgagcggtccccgaagcgaaatcactatcataggatcc
tctgttcaggtgatatcaaatctttctgctaccactggacctctcttttatatggaatca
tggggtcgttttccaaaggaaaggaaacgtctttttaaactgatagcagatactaagaga
gatggagttatattcatcagtggagatgtacattttggagaaatcacgagatatgattgt
tctgttgggtacccattatatgatgtcacctccagtggtctagtacaatctgttgagaaa
gttgtccctcgtcccttgcgttccatagttaggcttcttttttggtatactccaagcacg
atgagagttatcaatgataactgcaaattcaaatcttgcacatacggtattattctcaat
ttgattccttttacgttttcttctgataaactgtggaaagatttattgacaagccaagac
acactcgagatcagagatgttaacggagacactgtactaggcacgaatgtttcattatct
gaactccaaccaggaggctcgaattctttaaaagatacaacaactaagggaaagtctcaa
cgatattgcacactcgaaattgaattaccaggaacgaccagataccgattggcagttctc
atctacttcaccattgctgtcttggcaatggcgatattaggacttatcattggagctgta
ttggccataacagcatgcgtttataaatgcaaggtcgattga

DBGET integrated database retrieval system