KEGG   Arabidopsis thaliana (thale cress): AT5G42800Help
Entry
AT5G42800         CDS       T00041                                 

Gene name
DFR
Definition
(RefSeq) dihydroflavonol-4-reductase
  KO
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    AT5G42800 (DFR)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     AT5G42800 (DFR)
    1.1.1.234  flavanone 4-reductase
     AT5G42800 (DFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 382 aa AA seqDB search
MVSQKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTL
WKADLSEEGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTV
RRFVFTSSAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEE
KGLDFISIIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIF
LYEQAAAKGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTDM
GFNFKYSLEEMFIESIETCRQKGFLPVSLSYQSISEIKTKNENIDVKTGDGLTDGMKPCN
KTETGITGERTDAPMLAQQMCA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcagaaagagaccgtgtgtgtaaccggcgcttcgggtttcatcggttcatgg
ctagtgatgcgattactagaacgtggttactttgttcgtgccaccgttcgagatcccggt
aatttgaagaaagtacaacatcttcttgatttgccaaacgccaagacgctactcacttta
tggaaggctgatttatctgaggaaggaagctacgatgatgccataaacggatgtgacggt
gttttccacgtggcaacacccatggattttgaatcaaaagatcctgagaacgaagtgata
aagccgacagtgaatggaatgttggggataatgaaagcatgtgttaaggcaaagaccgta
cgaagattcgtatttacttcatctgccggaaccgttaatgtagaagaacatcagaagaat
gtctatgatgaaaatgattggagtgatcttgagtttatcatgtccaaaaagatgacagga
tggatgtatttcgtgtcaaaaacgttagcggagaaagcagcgtgggatttcgccgaagag
aaaggattagatttcattagtattattccaacattggtggtcggtccattcatcacaacg
tctatgccgcctagccttatcaccgcgctctctcctatcactcggaacgaggcgcattac
tcgatcataagacaaggacagtatgtgcatttggacgacttatgcaacgctcatatcttc
ttatacgaacaagcagccgccaagggacgttatatttgttcctctcatgatgcaaccatt
cttactatctccaaatttctcaggccaaaataccccgaatataacgtaccttcaacgttt
gaaggtgttgatgagaatctaaagagcattgaattcagttccaagaagctgacggacatg
gggtttaacttcaagtatagtctcgaggaaatgtttattgaatctattgagacatgtcgt
caaaagggttttctcccggtttcattatcgtaccaatccatatcggagatcaagactaag
aatgaaaacattgacgtcaaaaccggagatggtttaaccgatggtatgaagccatgtaac
aagacagaaacggggataaccggcgagagaaccgatgctcccatgctagcacaacagatg
tgtgcctag

DBGET integrated database retrieval system