KEGG   Arabidopsis thaliana (thale cress): AT5G42800Help
Entry
AT5G42800         CDS       T00041                                 

Gene name
DFR
Definition
dihydroflavonol-4-reductase
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:ath00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 382 aa AA seqDB search
MVSQKETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTLLTL
WKADLSEEGSYDDAINGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTV
RRFVFTSSAGTVNVEEHQKNVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDFAEE
KGLDFISIIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIF
LYEQAAAKGRYICSSHDATILTISKFLRPKYPEYNVPSTFEGVDENLKSIEFSSKKLTDM
GFNFKYSLEEMFIESIETCRQKGFLPVSLSYQSISEIKTKNENIDVKTGDGLTDGMKPCN
KTETGITGERTDAPMLAQQMCA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcagaaagagaccgtgtgtgtaaccggcgcttcgggtttcatcggttcatgg
ctagtgatgcgattactagaacgtggttactttgttcgtgccaccgttcgagatcccggt
aatttgaagaaagtacaacatcttcttgatttgccaaacgccaagacgctactcacttta
tggaaggctgatttatctgaggaaggaagctacgatgatgccataaacggatgtgacggt
gttttccacgtggcaacacccatggattttgaatcaaaagatcctgagaacgaagtgata
aagccgacagtgaatggaatgttggggataatgaaagcatgtgttaaggcaaagaccgta
cgaagattcgtatttacttcatctgccggaaccgttaatgtagaagaacatcagaagaat
gtctatgatgaaaatgattggagtgatcttgagtttatcatgtccaaaaagatgacagga
tggatgtatttcgtgtcaaaaacgttagcggagaaagcagcgtgggatttcgccgaagag
aaaggattagatttcattagtattattccaacattggtggtcggtccattcatcacaacg
tctatgccgcctagccttatcaccgcgctctctcctatcactcggaacgaggcgcattac
tcgatcataagacaaggacagtatgtgcatttggacgacttatgcaacgctcatatcttc
ttatacgaacaagcagccgccaagggacgttatatttgttcctctcatgatgcaaccatt
cttactatctccaaatttctcaggccaaaataccccgaatataacgtaccttcaacgttt
gaaggtgttgatgagaatctaaagagcattgaattcagttccaagaagctgacggacatg
gggtttaacttcaagtatagtctcgaggaaatgtttattgaatctattgagacatgtcgt
caaaagggttttctcccggtttcattatcgtaccaatccatatcggagatcaagactaag
aatgaaaacattgacgtcaaaaccggagatggtttaaccgatggtatgaagccatgtaac
aagacagaaacggggataaccggcgagagaaccgatgctcccatgctagcacaacagatg
tgtgcctag

DBGET integrated database retrieval system