KEGG   Arabidopsis thaliana (thale cress): AT5G43340Help
Entry
AT5G43340         CDS       T00041                                 

Gene name
PHT1;6
Definition
(RefSeq) phosphate transporter 1;6
  KO
K08176  MFS transporter, PHS family, inorganic phosphate transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transporters [BR:ath02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Phosphate:H+ symporter (PHS) family [TC:2.A.1.9]
    AT5G43340 (PHT1;6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF1218
Motif
Other DBs
NCBI-GeneID: 834352
NCBI-ProteinID: NP_199148
MIPS: AT5G43340.1
TAIR: AT5G43340
Araport: AT5G43340
UniProt: Q9ZWT3
Position
5
AA seq 516 aa AA seqDB search
MANEEQGSILKALDVAKTQWYHVTAVVVSGMGFFTDSYDLFVISLITKLLGRIYYQVPGS
SSPGSLPDGISAAVSGVAFAGTFIGQIFFGCLGDKLGRKRVYGLTLLIMTICSICSGLSL
GRDPKTVMVTLCFFRFWLGFGIGGDYPLSATIMSEYSNKRTRGAFIAAVFGMQGIGILAA
GAVSLLVSAVFESKFPSRAYILDGAASTVPQADYVWRIILMVGALPALLTYYWRMKMPET
ARYTALVSKNAEQAALDMTKVLNVDIEASAAKNDQARVSSDEFGLFSMKFLRRHGLHLLG
TASTWFLLDIAFYSQNLFQKDIFTTIGWLPSAKTMNAIQELYMIAKAQTIIACCSTVPGY
FFTVGFIDYMGRKKIQIMGFAMMTIFMLSLAIPYHHWTLPANRIGFVVLYSFTFFFSNFG
PNATTFIVPAEIFPARIRSTCHGISAASGKAGAMVGSFGFSALVKALGMSNTLYIMAGIN
LLGLLLTFTIPETNGKSLEELSGETEPEKIKEKIVV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgaagaacaaggaagcatcttgaaagctcttgacgttgcaaagactcaatgg
taccacgtcacggcggttgtagtctccggtatgggtttcttcacagactcatacgatctc
ttcgtgatatctcttatcacgaagcttcttggccggatctactatcaggttcctggctcc
tcctctcccggaagcctccctgacggcatctctgcggccgtgagtggtgtggccttcgct
ggaacgtttatcggacagattttctttgggtgtcttggtgacaagcttggacgtaagaga
gtctatggtttgactctcttgatcatgaccatatgctccatttgttctggtctttccctt
ggaagagacccgaaaaccgtcatggtaactctctgcttcttccgcttctggctcgggttt
ggcatcggtggtgactatcctctctcggctacgatcatgtccgagtattccaacaaacgt
actcgcggtgctttcatagcagctgttttcggtatgcaagggattgggatccttgccgca
ggagctgtctcgttacttgtctcagctgttttcgagagtaagtttccgtcccgagcctat
atattggatggtgcagcctccaccgtcccacaggcggattacgtttggaggatcatcctg
atggtcggcgccttaccagctctcttgacctactactggcggatgaagatgcccgaaacc
gctcgttacacggctcttgtctccaagaacgcggagcaagcggctttagatatgactaag
gttctcaacgtagacattgaagcctctgccgcaaagaatgatcaagctagggtttcctcg
gacgagtttggcttgttctccatgaagttccttcgccgtcacggactccacttactcgga
acagcctccacatggttcctcctcgacatcgctttctacagccaaaacttgttccagaag
gatatcttcaccaccattgggtggttaccttcggctaaaaccatgaacgcaatccaagag
ctctacatgatcgctaaggctcaaaccataatcgcttgttgcagcaccgttcccggttac
tttttcactgtagggttcatcgattatatgggacggaaaaagatccagatcatgggtttc
gctatgatgaccatcttcatgctcagtttagccataccgtaccatcattggaccttaccg
gctaaccggattggtttcgtcgttctttactctttcacatttttcttctccaattttgga
cctaacgcaactactttcattgtcccggctgagattttcccggcgaggataaggtcgact
tgtcacggtatatcggcggcgtctggtaaagccggtgcgatggtcggttctttcgggttt
tcggctttggttaaagctttgggtatgagtaacacgttatacatcatggcaggaatcaat
ttgcttggcttgcttctcacgtttacaattccggagactaatgggaaatcacttgaggag
ctttccggcgaaactgagccggagaaaatcaaggagaagattgttgtttag

DBGET integrated database retrieval system