KEGG   Arabidopsis thaliana (thale cress): AT5G43350Help
Entry
AT5G43350         CDS       T00041                                 

Gene name
PHT1;1
Definition
(RefSeq) inorganic phosphate transporter 1-1
  KO
K08176  
MFS transporter, PHS family, inorganic phosphate transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Transporters [BR:ath02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Phosphate:H+ symporter (PHS) family [TC:2.A.1.9]
    AT5G43350 (PHT1;1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 524 aa AA seqDB search
MAEQQLGVLKALDVAKTQLYHFTAIVIAGMGFFTDAYDLFCVSLVTKLLGRIYYFNPESA
KPGSLPPHVAAAVNGVALCGTLSGQLFFGWLGDKLGRKKVYGLTLVMMILCSVASGLSFG
HEAKGVMTTLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGVGILAGG
FVALAVSSIFDKKFPAPTYAVNRALSTPPQVDYIWRIIVMFGALPAALTYYWRMKMPETA
RYTALVAKNIKQATADMSKVLQTDIELEERVEDDVKDPKQNYGLFSKEFLRRHGLHLLGT
TSTWFLLDIAFYSQNLFQKDIFSAIGWIPKAATMNATHEVFRIARAQTLIALCSTVPGYW
FTVAFIDTIGRFKIQLNGFFMMTVFMFAIAFPYNHWIKPENRIGFVVMYSLTFFFANFGP
NATTFIVPAEIFPARLRSTCHGISAAAGKAGAIVGAFGFLYAAQSQDKAKVDAGYPPGIG
VKNSLIMLGVLNFIGMLFTFLVPEPKGKSLEELSGEAEVSHDEK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaacaactaggagtgctaaaggcactcgatgttgcgaagacgcaactttat
catttcacggcgattgtcatcgccggtatgggtttctttaccgatgcctacgatcttttt
tgcgtgtccttggtgacgaaactccttggccgcatctactatttcaatccggagtcagcg
aagcctggctcacttccccctcatgttgcggccgcggtcaacggtgtggccctttgtgga
accctttctggtcaactcttcttcggttggctcggtgacaaactcggacggaaaaaagtg
tacggtctcactttggtaatgatgatcttgtgctctgtcgcttctggtctctcttttggc
cacgaagccaagggtgtcatgaccaccctttgcttcttcaggttttggttgggatttggt
attggaggtgactacccactttctgccaccatcatgtctgaatacgcaaacaagaagacc
cgtggggctttcatcgcagctgtcttcgccatgcaaggtgtcggtatcttggctggaggt
ttcgtggcactcgcagtatcttctatattcgacaaaaagttcccagctccaacatatgca
gtaaacagggccctctcaacgcctcctcaagttgactacatttggcgaatcatcgtcatg
tttggtgctttacccgcagctttgacttactactggcgtatgaagatgcctgaaactgcc
cgttacaccgctttggttgccaagaacatcaaacaagccacagccgacatgtccaaggtc
ttacaaacagatatcgagcttgaggaaagggtggaggatgacgtcaaagaccccaaacaa
aactatggcttgttctccaaggaattccttagacgccatgggcttcatctccttggaact
acctccacatggtttttgcttgacattgccttctacagccaaaacttgttccagaaggat
attttctcggccatcggatggatcccaaaggcagccaccatgaacgccacccatgaggtt
ttcaggattgctagggctcagactcttatcgccctttgcagtacagtcccaggctactgg
ttcacagttgcgtttattgataccattggaaggtttaagatccaactaaatggatttttc
atgatgaccgtgtttatgtttgccattgccttcccttacaaccactggatcaaaccagaa
aaccgtatcggatttgtggttatgtactctcttactttcttcttcgccaattttggtcca
aatgcaaccacttttattgtccctgctgagatattcccggccaggctaaggtctacatgt
catggaatatcagccgcggctggtaaggctggagccattgttggagcctttgggttccta
tatgcggctcaatcacaagacaaggccaaggtagacgcaggatacccaccaggcatcgga
gttaagaactcattgatcatgcttggtgttcttaactttatcggtatgctcttcaccttc
cttgtcccagagcccaaaggcaagtcccttgaagaactctctggtgaggctgaggttagc
catgacgagaaataa

DBGET integrated database retrieval system