KEGG   Arabidopsis thaliana (thale cress): AT5G47100Help
Entry
AT5G47100         CDS       T00041                                 

Gene name
CBL9
Definition
(RefSeq) calcineurin B-like protein 9
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Protein phosphatases and associated proteins [BR:ath01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AT5G47100 (CBL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_7 EF-hand_4 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 834756
NCBI-ProteinID: NP_199521
MIPS: AT5G47100.1
TAIR: AT5G47100
Araport: AT5G47100
UniProt: Q9LTB8
Position
5
AA seq 213 aa AA seqDB search
MGCFHSTAAREFPDHENPVKLASETAFSVSEVEALYELFKSISSSVVDDGLINKEEFQLA
LFKNRKKENLFANRIFDLFDVKRKGVIDFGDFVRSLNVFHPNASLEEKTDFTFRLYDMDC
TGFIERQEVKQMLIALLCESEMKLADDTIEMILDQTFEDADVDRDGKIDKTEWSNFVIKN
PSLLKIMTLPYLRDITTTFPSFVFNSEVDEIAT
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtttccattccacggctgccagagaatttcccgatcacgaaaaccctgtgaag
cttgcttctgagactgcttttagtgttagtgaagttgaagcattgtatgaattgttcaag
agcataagcagctcggttgttgacgatggcttgataaacaaggaagagtttcaacttgct
ttgttcaagaacagaaagaaagaaaatttgtttgccaataggatatttgatttatttgat
gttaaacgaaaaggcgtaattgattttggagactttgtgagatcactcaatgttttccat
cctaatgcttccctagaggagaaaacagactttacctttaggctttacgacatggactgc
acaggcttcattgagcgccaagaggtgaagcagatgttgattgcacttctctgcgaatct
gaaatgaaactggctgatgatacaatagagatgatacttgatcagacatttgaggacgca
gatgtggatcgggatggaaagattgataagacagaatggagcaatttcgttatcaaaaac
ccatctttgcttaaaatcatgactcttccgtatctcagggatataacgacgacatttccg
agtttcgtatttaactcggaggtggacgagattgcgacgtga

DBGET integrated database retrieval system