KEGG   Arabidopsis thaliana (thale cress): AT5G47330Help
Entry
AT5G47330         CDS       T00041                                 

Definition
palmitoyl protein thioesterase family protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AT5G47330
  Lipid metabolism
   00062 Fatty acid elongation
    AT5G47330
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     AT5G47330
Lipid biosynthesis proteins [BR:ath01004]
 Fatty acid synthase
  Component type
   AT5G47330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 314 aa AA seqDB search
MGEKGLKRSGVAVVVALLAMVHVSVSVPFIMLHGISAQCSNARDANFTQLLTNLSGSPGF
CLEIGNGVADSWLMPLTRQAEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGP
PVYNYISLAGPHAGISSVPMCGSGLFCKLADELIKGDIYSDFIQDHLAPSGYLKIPTDMT
KYLGSSKYLPKLNNEIPDQRNQTYKDRFTSLHNLVLIKFQGDKVIVPKDSSWFGFYPDGE
FEPLLSAQQTKLYTEDWIGLKTLDDAGKVKFVSVAGEHIRMVDEDVVKHVVPYLQDQPSS
VQSFNRKTKQPLHA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggagagaaaggtttgaagcggtctggtgttgcggtggtggttgcattactagccatg
gttcatgtctctgtttcagttccgttcataatgcttcatgggatctcagctcaatgttct
aatgctagggatgctaacttcacacagcttctcactaacctctctggctctcctggcttt
tgcttagaaattggaaatggagttgccgattcatggttaatgccgcttacacgacaagcg
gaaatagcgtgtgagaaggtgaagcaaatgaaagagttgagtcaaggatacaacattgtt
ggaagatctcaggggaacctagtggctcgaggcttgatcgagttctgtgacggtggccct
ccggtttacaactatatatccttggccggtcctcatgctggcatctcctctgttcctatg
tgtggttctggtttattctgtaagttagcagatgagctaatcaagggagatatctatagc
gacttcattcaagatcatcttgctcctagtggttatctcaaaattcctactgatatgaca
aagtacttgggaagctctaagtatttacctaagcttaacaatgagataccagaccaaaga
aaccaaacttacaaagaccgtttcaccagtttacataacttggttcttatcaagtttcag
ggcgacaaggttatagttccaaaagattcatcttggttcgggttttatccggatggtgaa
ttcgaacctcttctctctgctcaacagacaaagctctatacagaggattggatcggtctg
aaaacattggatgatgcgggaaaagtgaagtttgtgagtgtagccggtgaacatatcaga
atggtagatgaagatgtcgtcaaacacgttgtaccttatctccaggaccaaccgtcttcg
gtgcaaagcttcaaccgcaagacgaagcagcccttgcatgcttaa

DBGET integrated database retrieval system