KEGG   Arabidopsis thaliana (thale cress): AT5G48220Help
Entry
AT5G48220         CDS       T00041                                 

Definition
(RefSeq) Aldolase-type TIM barrel family protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01230  Biosynthesis of amino acids
Module
ath_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT5G48220
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AT5G48220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS ThiG
Motif
Other DBs
NCBI-GeneID: 834875
NCBI-ProteinID: NP_001078734
MIPS: AT5G48220.1
TAIR: AT5G48220
Araport: AT5G48220
UniProt: A8MS79
Position
5
AA seq 316 aa AA seqDB search
MYQNEVVESQGIRIRRRPPTGPPLHYVGPFEFRLQNEGNTPRNILEEIVWHKDKEVAQMK
ERKPLYSLKKALDNVPPAKDFIGALRSAHQRTGLPGLIAEVKKASPSRGILREDFNPVEI
AQAYEKGGAACLSVLTDDKYFKGSYENLQAIMEAGVKCPLLLKEFIVEAWQIYYGRSKGA
DAVLLIASVLPDLDIKYMIKICKILGMATLVEVHDEREMDRVLAIEGVELIGINNRNLET
FEVDLGITKKLLEGERGELIRQKDILVVGESGLFTPEDIAFVQEAGVKAVLVGESLIKQS
DPGKAISTLFGRDVSE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagaatgaagtagttgagagtcaaggtataaggataaggagaagaccacctact
ggacctccattgcattacgttggaccttttgagttccggcttcagaacgagggaaacacg
cctcgtaacatcttggaagagatcgtatggcacaaggataaagaagttgctcagatgaaa
gagagaaagcctctttatagcttgaagaaggctcttgataatgttcctcctgctaaagac
ttcattggtgctcttagatcggctcaccaaagaacggggttgcctggtttaatagctgag
gttaagaaagcttctccaagtagaggaatcctgagagaggattttaaccctgttgaaatt
gcacaagcttatgagaaggggggagcagcatgtcttagtgttttgacagatgacaaatac
ttcaagggaagctatgagaacctgcaagctataatggaagctggtgtgaagtgccctttg
ctattgaaagagttcattgttgaggcatggcagatatactatggtagaagtaaaggcgca
gatgcagttttgttgatcgcttctgtgttacctgaccttgacatcaaatacatgattaag
atttgcaaaatacttggaatggctacacttgtggaggtccatgacgaaagggagatggat
cgtgttcttgcaattgaaggagtcgagctcattggcatcaataaccgtaaccttgaaaca
tttgaggtagatcttggtatcacaaagaagctacttgagggagagcgtggcgaactgatc
cgtcaaaaagacatccttgtggttggagaatctgggttattcactcccgaagatatcgcc
tttgttcaagaagccggtgtcaaagcagttttagtcggcgaatctcttattaaacaaagc
gatcccgggaaggcaatcagcaccctatttggaagagatgtctcagagtaa

DBGET integrated database retrieval system