KEGG   Arabidopsis thaliana (thale cress): AT5G49900Help
Entry
AT5G49900         CDS       T00041                                 

Definition
Beta-glucosidase, GBA2 type family protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ath00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ath00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 957 aa AA seqDB search
MFEEKIMDIGEDVKPLNSSDTKVDPAVPASLTWQRKIDSDVKAPREFNLSVKEIFQLAPV
GIRLWFLCREEAAKGRLAFIDPFSKHSVTSSHGVPLGGIGAGSIGRSFKGEFQRWQLFPP
KCEDEPVLANQFSAFVSRANGKKYSSVLCPRNPKLDKQDSESGIGSWDWNLKGDKSTYHA
LYPRSWTMYEGEPDPELRIVCRQVSPFIPHNYKESSFPVSVFTFTLHNLGNTTADVTLLF
TWANSVGGDSEFSGGHYNSKITMNDGVQGVLLHHKTANGLPSLSYAISAQATDGVSVSAC
PFFIVSGKQDGITAKDMWQAVKENGSFDHLKASEASMQSDHGSSIGAAVAASVTVLPGES
RIVTFSLAWDCPEVQFPSGKIYSRRYTKFYGNNGDAAAQIAHDAILGHSQWESWIEDWQR
PILEDKRLPAWYPVTLFNELYYLNSGGTLWTDGSSPVHSLAGVREKKFSLDKSQLGLKND
IDVPHQNDTAVSVLEKMASTLEELHASTTSNSAFGTKLLEEGEENIGHFLYLEGIEYRMW
NTYDVHFYASFALVMLFPKLELSIQRDFAAAVMLHDPTKVKTLSEGQWVQRKVLGAVPHD
LGINDPWFEVNGYTLHNTDRWKDLNPKFVLQVYRDVVATGDKKFASAVWPSVYVAMAYMA
QFDKDGDGMIENEGFPDQTYDTWSASGVSAYCGGLWVAALQAASALARVVGDKNSQDYFW
SKFQKAKVVYEKKLWNGSYFNYDNSGSQYSSTIQADQLAGQWYARASGLLPIVDEDKART
ALEKVYNYNVMKIKDGKRGAVNGMHPNGKVDTASMQSREIWSGVTYALSATMIQEGLVEM
AFQTASGIYEAAWSETGLGYSFQTPESWNTVDEYRSLTYMRPLAIWAMQWALTKTSQKQE
QLGLEPEQQEPELEPSSSMKHDIGFSRVSRLLSLPNEASAKSTLQTLFDYTCRRMMS
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaggaaaagatcatggatattggtgaagatgtaaaacctttaaactcttctgat
actaaagttgatccggcagtacctgcatctttgacatggcaaagaaagatagatagtgac
gtaaaagctccacgggaattcaatctgagtgttaaagagattttccagctggctcctgtt
ggcattcggttatggtttctttgcagagaagaagctgctaaaggaaggttggccttcata
gatccattctccaagcactctgtaacgtcttcccatggtgttccacttggaggtattgga
gctggaagcataggaaggagttttaaaggtgaattccagagatggcagctattccctcca
aaatgtgaagatgaaccagtgttagcaaatcaattctcagcatttgtttcacgtgctaat
ggtaaaaagtactcgagtgtgttatgtcctaggaacccaaagcttgacaaacaagattcg
gaatcaggtattggttcttgggactggaatctgaaaggagacaagtctacataccatgct
ttatatccgaggtcttggacaatgtatgagggtgaacctgatccagagcttaggattgtt
tgtcgtcaagtttcaccctttatacctcacaactacaaagaaagcagctttccagtgtct
gttttcactttcacacttcataatctcggaaacactaccgcggatgtgacattgctcttc
acttgggcgaattctgttggaggagactctgagttctcaggtggccactacaactccaag
ataacgatgaatgatggagttcagggtgtgctcttacatcataaaacagcaaacggatta
ccatcattgtcatatgcaatttcagctcaggccaccgatggtgttagtgtctcagcttgc
ccatttttcatagtgtctggaaagcaggatggaatcacagcaaaagatatgtggcaggct
gtcaaagagaatggttctttcgatcacttaaaggcttctgaggcgtcaatgcagtcagat
cacggttcatccattggggcagcagtagcagcctctgtaacagtcctaccgggagagtca
cgcattgtcacattttctctggcttgggactgccctgaagtgcagtttcctagtggtaaa
atatattctaggcgttacacaaagttttatggcaataatggtgatgctgcagcacaaatt
gcacatgatgctattcttggacatagtcaatgggagtcctggatagaagattggcaaaga
ccaatacttgaagacaaaagactgcctgcatggtaccctgtcactctcttcaacgagctt
tattaccttaattcaggaggaactctttggacagatggatcatccccagtacatagcttg
gcaggagtcagagaaaagaagttctcacttgataaatcccaactcggtctaaagaacgat
atcgatgtaccgcatcagaatgatacagctgtctctgtccttgaaaagatggcttctacg
cttgaggaacttcatgcatcaacaacgtcaaactctgcatttggcacaaaattacttgaa
gaaggagaagagaacattgggcacttcctttacttagaagggattgaatatcgtatgtgg
aacacttacgatgttcatttctatgcatcttttgcactggtgatgctgtttccaaaactg
gaacttagtatccaaagagactttgctgctgcagtgatgctacacgatcctactaaagtg
aaaactcttagtgagggacaatgggttcagaggaaggttcttggtgcagttcctcatgac
ttaggcattaatgacccttggtttgaagttaatggatatactcttcacaatacggatcgt
tggaaagatttgaaccccaaatttgtcctccaggtgtaccgggatgtagttgccacaggc
gataagaagtttgcatcagcggtctggccctcagtgtatgttgcaatggcatatatggct
cagtttgacaaagatggcgacggaatgattgagaacgaaggatttccagatcagacttac
gatacatggtcggcgtctggtgtaagcgcttactgtggtggactttgggtggctgcactg
caagctgcatctgcattggcacgcgtagtgggtgacaagaactctcaggattatttctgg
tctaagtttcagaaagcaaaagttgtatatgagaagaagttatggaatggatcttacttt
aactatgataatagtggaagtcagtatagctcaactatccaagctgatcaactagctggt
caatggtacgcgagagcatcagggcttttgcctatagtagatgaagacaaagcaagaact
gctttggagaaagtttataactataatgtgatgaagattaaagatgggaaacgtggagct
gtaaatgggatgcatcccaatgggaaagttgatacagcgtcaatgcaatcacgagagata
tggtccggtgttacatatgcactgtctgcaacaatgatccaagaaggtctagttgaaatg
gcgtttcagactgcaagtggtatctatgaagctgcctggtctgaaaccggactcgggtat
tcctttcagacgcctgaatcttggaacacggttgatgagtatagatcattgacttacatg
cgtccccttgcaatatgggctatgcaatgggcactgacaaaaaccagtcaaaaacaggaa
caacttggtcttgaaccagagcaacaagaaccagaactagagcctagttcttcaatgaaa
catgatattgggttttctcgggtttctaggcttctgagcttacctaatgaagcatcagcc
aaaagcacactccagactttgttcgactatacttgcaggagaatgatgtcatag

DBGET integrated database retrieval system