KEGG   Arabidopsis thaliana (thale cress): AT5G50240Help
Entry
AT5G50240         CDS       T00041                                 

Gene name
PIMT2
Definition
protein-l-isoaspartate methyltransferase 2
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AT5G50240 (PIMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 306 aa AA seqDB search
MNTNTQTEQQIIREETRIDKIIKKRKKKMRAQVLLCPTITAYGRLYCAPRRLHRYNSSSS
SSQFLNLNLSRFSGALFFHMESGTGSSGKRGMVENLKRYGVISSKRVAQVMEALDRGLFV
PVGSSAYVDTPVPIGYNATISAPHMHATCLQLLEDKLHPGMRALDVGSGTGYLTGCFALM
VGAEGRVVGVDHIPELVDMSIKNIEKSVAASFLKKGSLSLHVGDGRKGWQEFAPYDAIHV
GAAASEIPQPLLDQLKPGGRMVIPLGTYFQELKVIDKNEDGSIKVHTETSVRYVPLTSRV
EQLGGF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgaacacacaaacagaacaacagatcatcagagaagaaactagaattgacaaa
attattaaaaagcgaaaaaagaaaatgagagctcaggttttattatgtccaacaataaca
gcttatggtcgtctctattgtgcgccacgtagacttcaccgctacaattcatcatcatca
tcatctcagtttctgaatctcaatctctctcgcttctccggtgctctcttcttccacatg
gagagtggaactggctcgagcggcaagagagggatggtggaaaatttgaagcggtacggt
gtgatatcgtcgaaaagagtagctcaagttatggaggctttagatagaggtctctttgta
ccagttggttcttcagcttatgttgatactcctgtacctataggttataatgctaccatt
tctgctccgcatatgcatgctacttgcttgcagctcttggaagataagctccaccccggg
atgcgcgctttagatgtcggctcaggaaccgggtacttgactggctgttttgctttgatg
gttggagctgagggacgtgttgttggcgtggatcatatccctgaattggttgatatgtct
atcaagaatatcgaaaagagtgttgctgcttcctttcttaagaaaggatctctctcctta
catgttggggatggaagaaaaggttggcaagagtttgcaccgtatgatgcaatacacgta
ggagcagcggcatcagaaatccctcagccccttttggatcagctaaaacccggtggacga
atggtgattccactaggaacctattttcaagagctcaaggtaatcgacaaaaacgaggat
ggttcaatcaaggtacataccgaaacttcagtccggtatgtgcccctcactagccgtgtc
gaacagttaggaggattttga

DBGET integrated database retrieval system