KEGG   Arabidopsis thaliana (thale cress): AT5G50320Help
Entry
AT5G50320         CDS       T00041                                 

Gene name
ELO3
Definition
Elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AT5G50320 (ELO3)
Transfer RNA biogenesis [BR:ath03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    AT5G50320 (ELO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 565 aa AA seqDB search
MATAVVMNGELKKQPRPGKGGYQGRGLTEEEARVRAISEIVSTMIERSHRNENVDLNAIK
TAACRKYGLARAPKLVEMIAALPDSERETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHI
ATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSV
DKVEFILMGGTFMSLPAEYRDFFIRNLHDALSGHTSANVEEAVAYSEHSATKCIGMTIET
RPDYCLGPHLRQMLIYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVV
AHMMPDLPNVGVERDMESFKEFFESPSFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPP
EQLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVR
TREAGIQDIHHKIKPEQVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGKNVTC
PELMGKCSVVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARREHRSNKIGVIS
GVGTRHYYRKLGYELEGPYMVKHLL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcggtagtgatgaacggcgagctgaaaaagcaacctcggccaggtaaaggc
ggctatcagggccgtggattaactgaagaagaagctcgagttcgcgccatatcggagatt
gttagcaccatgattgagcgttcacaccgcaacgagaatgttgacctaaacgcaattaaa
accgccgcttgccggaaatacggcctagcacgtgcgcctaagctcgtggagatgattgct
gcgcttcctgattcagagagagagactcttctcccgaagctccgtgccaaaccggttcga
acagcttcagggatcgccgttgtggcggttatgtcgaagcctcataggtgcccgcatata
gctacgacggggaatatatgcgtttattgtcccggtggacctgactctgactttgagtat
agtactcagtcttacactggatatgagcctaccagcatgcgagctattcgagccaggtac
aatccatatgttcaggcaagaagcaggatagatcagctgaagcggttgggtcacagtgta
gataaggttgagttcattttgatgggaggtactttcatgtcactgcctgctgagtatcgg
gatttcttcatacggaatcttcatgatgctttatcaggacacacttctgccaacgttgaa
gaggcagttgcttactctgaacatagtgcaactaaatgcattgggatgacaattgaaacg
aggccagattactgccttggacctcatttacgacaaatgctgatttacggttgcacccgg
ctagagataggtgtccagagcacatatgaagatgttgcccgtgacacaaatagaggtcat
actgttgctgctgtagctgactgcttctgcttggctaaagatgctggtttcaaggtggtt
gcacatatgatgcctgatcttcctaatgttggggttgagagagacatggaaagtttcaag
gagtttttcgagagcccatcttttagagcagatgggttaaaaatatatcccacccttgtg
atccgtggaactggactttatgaactatggaaaactgggaggtaccgaaattatccacct
gagcagcttgtggatatagttgcaaggattctctccatggtacctccatggacacgtgta
tatagagttcagcgtgatattcctatgcctctggttacgtcaggggtagaaaaaggaaat
cttcgtgaactggctctagccagaatggatgacttgggccttaaatgccgtgatgtccgt
actcgtgaagctggaattcaggacattcatcataaaattaagccagaacaagtagagctt
gtgcgtcgtgattacactgccaatgaaggttgggagacgttcctttcttatgaagataca
cgccaggacattcttgttggattgctacgtttgcgaaaatgcgggaagaatgtaacgtgt
ccagaactcatgggaaagtgttctgttgtccgtgagcttcatgtatacggaacagctgta
ccagttcatggtcgagatgctgataagttgcaacatcagggctatggtacacttctgatg
gaagaagcagagaggattgctagaagagaacatcgatctaacaaaatcggtgtgatttct
ggtgtaggaaccagacattactacagaaagttgggttatgaattggaaggtccttacatg
gtgaagcatcttctttga

DBGET integrated database retrieval system