KEGG   Arabidopsis thaliana (thale cress): AT5G51200Help
Entry
AT5G51200         CDS       T00041                                 

Gene name
EMB3142
Definition
(RefSeq) nuclear pore complex protein (DUF3414)
  KO
K14310  
nuclear pore complex protein Nup205
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT5G51200 (EMB3142)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     AT5G51200 (EMB3142)
Chromosome [BR:ath03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    AT5G51200 (EMB3142)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
Araport: 
UniProt: 
Position
5
AA seq 1839 aa AA seqDB search
MVSPKDLVAIVHSSLLGTSRPTPTQRIELTHAIRNSFPSLQNLLSFPPPKPSDRAQVQSK
EIRLPDSLPISLDDQDIAISLKLSDELHLNEIDSVRLLVSSNQEWGLMGRDPLEIQRLAT
GLWYTGRRDLTSTLYTLLRAVVLDEGLEPDLIADIQGLLEELIEAGLRQRLITLIKELNR
EDPTGLGGPLCERYLIDSRGALVERRAVVQRERLILGHCLVLSILVDRPGSKDVKDIYYI
LKDNAAQLTEGNDTISSQITFSLLFSLIITFVSDAISRLSDKSSMISQDASFRTDFQDIV
MASGSDPTADGFIGGIRLAWAVHLMLIHDGISGMDTISTASTTDMGHICSCLESIFSKNV
FQFLLDNVLRTAAYQNDEEDIIYIYNAYLHKLASCFLSHPIARDKVKESKDMAMSVLNSY
RTSDPLDGSMQTEESDRPLPFISLMEFKEPELLSGNDVLWTFVNFAGEDHTNFKTLVAFL
EMLCTLASTQEGASKVYELLRGTSFRSIGWPTLFDCIRIYDEKFKQSLQTAGAMMPEFLE
GDAKALVAYLNVLQKVVENGNPTERKNWFPDIEPFFKLLGYENIPPYLKGALRKTIAAFV
NVFPEMRDSIWAFLEQYDLPVVVGSQVGKSDQSSQVYDMQFELNEVEARREQYPSTISFL
NLINALIAGEKDVNDRGRRAYSDPCEKWQLVVACLQHFHMILSMYDIQEEDLDGFTEHPH
FLVSLETSSLQTQLPIIELLKDFMSGKALYRNLMGILQVGVNSIISERLSKTYGKILEKA
VQLSLEILLLVFEKDLLVSDVWRPLYQPLDIILSQDHNQIIALLEYVRYDSLPQIQRSSI
KIMNILRCSRLVGLVPMLIKIDAANSLIEDYAACLEGRLEEGEVVENSCDDLGVLIMQLL
VDNINRPAPSITHLLLKFDLDAPVEGTVLQPKFHYSCLKVILEMLEKLPNPDINFLLFEF
GFQLLCELNLDPLTSGPTMDLLSSKKYQFFLQHLDTIGVATLPKRSGSQALRISSLHQRA
WLLKLLAIALHTGSGSSSAHLEACQSILSHLFGREVTEAANEPFSSSTYPQDGLDYAGTS
SISKSKALALLEILQFRSPDASMQLPQIVSSLKYDSLVEDILGNRDTSVSGSIYYYSERG
DRLIDLSSFSNKLWQKLHSGFPLVDSFPNVAELSEVRETIQQLLKWGWKYNRNLEEQAAQ
LHMLAGWSQIVEVSACRRISSLDNRSEILYRILDASLSASASPDCSLKMAFVLTQVALTC
IAKLRDDRFSFQGALSSDTVTCLDVMMVKHLSTGACHSVLFKLVMAILRHESSESLRRRQ
YALLLSYFQYCQHMIALDVPTSVVQFLLLNEQDGEDLDIQKIDKEQADLARANFFIIKKE
AQGILDLVIKDASQGSEFGKTISLYVLEALVCIDHERYFLSQLQSRGFIRSCLGSISNIS
YQDGTHLLESQQRACTLEAELALLLRISHKYGKSGGQVLFSMGALEHIASCRAISFKGNM
RRVDMKLQSDVGYNVQKQRTIITAVLRLVFALTSLVETSEFFEGRNKIVRDVVEFIKGHQ
SLFDQLLREDFTQADDLLMEQIILAVGILSKVWPFEENDGYGFVQGLFDMMSKLFIASPI
KSILSQKGSELKLSQLRFSLTSYLYFLVTKNSLRLQVSDDSLDSSTKLRQPTLLLLASLL
SHVTDSLERAAEKKSLLLHKIRDINELSRQDVDAIIKICDSQEYVTPSDNIHKRRYIAMV
EMCQIVGNRDQLITLLLQLAEHVLNIILIHLQDRSVSSNERGSYGSKSHIQQEVTDLCGK
LSPTIDRLALLNEGKVGHNLKVFQRLATTVKEMAIQKCV
NT seq 5520 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgccgaaagatttagtggcgatagtacactcttcgctgctcggaacatcccgg
ccaactccaacgcagcgtatcgaactcactcatgccattcgcaactcatttccctctctt
cagaacctcctctctttcccgcctccgaagccgtcggacagagcgcaagttcagtccaaa
gaaattcgactcccggattcgctgccaatatctttggatgaccaagatatcgctattagc
ttgaaactgagtgatgagcttcacctaaatgagatagattctgttcgtctgcttgtatct
tcgaatcaggagtggggcttaatgggacgagaccctcttgagattcaacggcttgcaact
ggactatggtatacagggagaagagatcttacatcaacgctatacacactcctgagggca
gttgttctggacgaggggcttgaacctgatcttatagctgacattcagggactcttagaa
gaactgattgaagctgggctcagacaacggttgattactcttataaaggaactcaatcgg
gaggatcctactggactgggtgggcccttatgcgagcgataccttattgactcaagaggt
gctcttgttgaacgaagagctgttgttcagagggaaagattgatactgggacattgcctt
gttctttcaattttggttgatagacctggttcgaaagatgtgaaggatatatactatatt
ttaaaagataatgcagctcaattaactgaaggaaatgacaccataagttctcagattact
tttagtcttctgttttctctcatcatcaccttcgtatcagatgcaatcagcagactatct
gataagtcatctatgatatctcaagatgcttcatttaggacagactttcaggatattgtc
atggcttctggcagtgaccccactgctgatggcttcattggtggcataaggcttgcctgg
gctgtacatttaatgctgatacatgatggaatatcgggaatggatacaatttccactgct
tcaacaacagatatggggcatatatgctcctgcctggagtccatcttctcaaaaaacgtg
tttcaatttttgctggataatgttcttcgaactgcagcctaccagaatgatgaggaggac
attatctacatatataatgcttatctgcacaagttagcctcttgttttttatctcacccg
atcgcaagagataaggtgaaggaatcaaaggacatggctatgagtgttctaaattcttac
cgaacttctgatccgcttgatggaagtatgcagactgaagagtctgacaggccactgccc
ttcatttctcttatggagtttaaggaacctgagctactctccgggaatgatgtcttgtgg
acttttgtgaattttgctggagaggaccacacaaattttaaaactcttgtggctttcttg
gaaatgctgtgtaccttggcttccactcaggaaggtgcttctaaagtttatgagttgctc
cggggtacatcatttcgcagtataggatggcccactttgtttgattgtataagaatttac
gatgagaagttcaagcagtctcttcaaactgctggagccatgatgccagagttcctggag
ggcgatgcaaaagcacttgtcgcttatctgaatgtacttcagaaggttgttgaaaatggt
aatcccactgagaggaaaaactggtttcctgatatcgaaccattttttaagcttctgggt
tacgaaaacatccctccatatctgaagggtgctcttagaaagaccattgctgcctttgtt
aatgtctttccagaaatgagggactctatctgggcttttcttgagcagtatgatctgcct
gttgttgtgggatcacaagttggaaagagtgaccaatcttctcaggtctatgatatgcaa
tttgagttaaatgaagtggaagcaaggagagaacagtatccttcaacaatatcgttcctt
aatcttataaatgctctgattgctggagagaaagatgtgaatgatcgtgggcgtagggca
tattcagatccctgtgagaagtggcaattggttgtggcatgccttcaacattttcacatg
atcttaagcatgtatgatattcaggaggaggatcttgatggatttactgagcatccacat
tttctggtgtcacttgaaacatcttcactgcaaacgcagctgccaattatagaattacta
aaagatttcatgagtgggaaagctctctataggaacctcatgggtatccttcaggttggg
gtcaattccatcatcagcgagcgattgagtaaaacttatgggaagatcttagaaaaggct
gtacaactttctttggaaatcttactactcgtctttgagaaggatttgcttgtttccgat
gtttggcgtccgctgtaccagcctttggatataattctctcacaagatcataatcaaatt
atagccttgttggagtatgtcagatatgattctcttcctcagattcagcgatcttcaatc
aaaatcatgaacattttaaggtgttctcgcttggttggacttgttccaatgctgatcaaa
attgatgctgcgaattccttgattgaggattatgccgcctgccttgagggacgacttgaa
gagggtgaagttgtagagaacagttgtgatgatctaggggtccttattatgcagcttctg
gttgataatatcaaccggcctgccccaagtatcacacatttgcttctgaagtttgatctt
gatgcccctgtggaagggacagttttgcagccgaagtttcactacagttgtctgaaggtc
attcttgaaatgctggagaagcttccaaaccctgatataaacttcttactctttgagttt
ggcttccagcttttgtgtgagttgaatttggatccactaactagtggtccaaccatggat
ctattgagcagcaaaaaatatcagttttttctccagcacctcgataccatcggtgttgcc
actcttccaaaaagaagtggcagccaagcactccgtattagttcccttcatcagagggcg
tggctattaaagctcctagctattgcactgcatactggttctggaagcagttcagctcac
ctagaggcatgtcagagcatactttctcatctttttgggcgggaggtaactgaagcagcg
aatgaacctttttcttccagtacatatcctcaggatggtcttgattatgctggaactagt
tcaatcagtaaaagtaaggcattggctttgcttgaaattcttcagtttagatctcctgat
gcttcgatgcagcttcctcaaattgtgtcaagcctaaagtatgactcattggtggaggac
atacttgggaaccgtgatacctctgttagcggcagtatttactattattctgagcgtggt
gatcggctaattgatctatcttccttcagcaacaaactctggcagaaactacattctgga
tttcccctagtagatagttttccaaatgttgctgagctgagtgaagttagagagacaatt
caacagctgttgaaatggggctggaagtataaccgaaaccttgaggagcaagctgcccaa
cttcatatgttagctggctggtctcagattgttgaggtgtctgcttgcagaagaatatct
tctcttgataaccggtctgaaattttgtaccggatacttgatgcctctcttagcgcctcc
gcgtctccagattgttcattaaaaatggcgtttgtactcactcaggttgcccttacctgc
attgccaaacttcgtgatgatagattttcatttcaaggggccttgagttctgataccgtg
acatgtctagatgttatgatggtcaaacatttatccactggtgcttgccactcagttcta
tttaaacttgttatggcaattctaaggcatgagtcatcagaatccttgagaaggcgccaa
tatgcattgctcttgagctatttccagtactgccagcatatgattgctcttgatgtgcca
acatcagttgtgcagttcttgttacttaatgagcaagatggtgaagatttggatatccag
aagattgacaaggagcaggctgaccttgctcgtgccaacttttttattataaagaaagaa
gctcagggcatcttggatctggtaatcaaggatgcaagtcaaggcagtgagtttgggaaa
acaatatcactttatgtgctggaagctcttgtttgtattgatcacgagagatattttctt
agtcagctccagagcagaggtttcatacgatcttgtcttggaagcattagtaatatctcc
taccaggatggaacacatttgctggagtcacaacagcgagcttgtacgttagaagcagaa
cttgcattgctacttagaattagtcacaagtacggaaagtctggaggccaggttctgttc
tccatgggtgcgctggaacatattgcttcatgtagagctatcagctttaagggaaatatg
aggcgtgtggatatgaaacttcagagtgatgtaggatataatgtgcaaaagcaacgaacg
ataatcactgctgtcctaagactggtgtttgctctaacctcattggttgagacctctgaa
ttttttgaggggaggaataaaattgttcgtgacgtcgttgagtttatcaaaggacatcaa
tctctgtttgaccaacttcttcgtgaagactttactcaagcagatgatttattgatggag
caaattattcttgcagtgggaatattgagcaaggtctggccttttgaagagaacgatgga
tatggatttgttcaagggctatttgatatgatgagcaagcttttcatcgcctccccgatt
aaatcgatattatcgcagaagggatcagagctcaaattgtctcagttgcgattcagcttg
acttcttacttatattttctggtgaccaaaaattctctgaggttacaggtttcagatgat
tctcttgatagttccactaaactacgccaaccaacattgctgttgcttgcatctcttctt
tcgcatgtgactgattccctcgagagagcagcagagaagaagtccttacttcttcataag
attagagacataaacgagctctcaagacaagatgtagatgcgatcatcaagatctgtgat
tcccaagaatatgtcacaccgtccgacaacatacataaaaggagatacatagctatggtt
gaaatgtgccaaatcgtgggtaacagggaccagttaatcaccttgttactgcaacttgcc
gagcatgtactaaatattatcctgatccatctccaagatagatccgttagttcaaatgaa
aggggatcatatggttcaaaatcccatatacaacaggaagttacagatctctgtggcaaa
ttgtcacctaccatagataggcttgcattactgaatgagggaaaagtaggacataacctg
aaggtgttccagagactggcaacgactgtaaaagaaatggccatccaaaagtgtgtatga

DBGET integrated database retrieval system