KEGG   Arabidopsis thaliana (thale cress): AT5G51200Help
Entry
AT5G51200         CDS       T00041                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT5G51200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 1838 aa AA seqDB search
MVSPKDLVAIVHSSLLGTSRPTPTQRIELTHAIRNSFPSLQNLLSFPPPKPSDRAQVQSK
EIRLPDSLPISLDDQDIAISLKLSDELHLNEIDSVRLLVSSNQEWGLMGRDPLEIQRLAT
GLWYTGRRDLTSTLYTLLRAVVLDEGLEPDLIADIQGLLEELIEAGLRQRLITLIKELNR
EDPTGLGGPLCERYLIDSRGALVERRAVVQRERLILGHCLVLSILVDRPGSKDVKDIYYI
LKDNAAQLTEGNDTISSQITFSLLFSLIITFVSDAISRLSDKSSMISQDASFRTDFQDIV
MASGSDPTADGFIGGIRLAWAVHLMLIHDGISGMDTISTASTTDMGHICSCLESIFSKNV
FQFLLDNVLRTAAYQNDEEDIIYIYNAYLHKLASCFLSHPIARDKVKESKDMAMSVLNSY
RTSDPLDGSMQTEESDRPLPFISLMEFKEPELLSGNDVLWTFVNFAGEDHTNFKTLVAFL
EMLCTLASTQEGASKVYELLRGTSFRSIGWPTLFDCIRIYDEKFKQSLQTAGAMMPEFLE
GDAKALVAYLNVLQKVVENGNPTERKNWFPDIEPFFKLLGYENIPPYLKGALRKTIAAFV
NVFPEMRDSIWAFLEQYDLPVVVGSQVGKSDQSSQVYDMQFELNEVEARREQYPSTISFL
NLINALIAGEKDVNDRGRRAYSDPCEKWQLVVACLQHFHMILSMYDIQEEDLDGFTEHPH
FLVSLETSSLQTQLPIIELLKDFMSGKALYRNLMGILQVGVNSIISERLSKTYGKILEKA
VQLSLEILLLVFEKDLLVSDVWRPLYQPLDIILSQDHNQIIALLEYVRYDSLPQIQRSSI
KIMNILRCSRLVGLVPMLIKIDAANSLIEDYAACLEGRLEEGEVVENSCDDLGVLIMQLL
VDNINRPAPSITHLLLKFDLDAPVEGTVLQPKFHYSCLKVILEMLEKLPNPDINFLLFEF
GFQLLCELNLDPLTSGPTMDLLSSKKYQFFLQHLDTIGVATLPKRSGSQALRISSLHQRA
WLLKLLAIALHTGSGSSSAHLEACQSILSHLFGREVTEAANEPFSSSTYPQDGLDYAGTS
SISKSKALALLEILQFRSPDASMQLPQIVSSLKYDSLVEDILGNRDTSVSGSIYYYSERG
DRLIDLSSFSNKLWQKLHSGFPLVDSFPNVAELSEVRETIQQLLKWGWKYNRNLEEQAAQ
LHMLAGWSQIVEVSACRRISSLDNRSEILYRILDASLSASASPDCSLKMAFVLTQVALTC
IAKLRDDRFSFQGALSSDTVTCLDVMMVKHLSTGACHSVLFKLVMAILRHESSESLRRRQ
YALLLSYFQYCQHMIALDVPTSVVQFLLLNEQDGEDLDIQKIDKEQADLARANFFIIKKE
AQGILDLVIKDASQGSEFGKTISLYVLEALVCIDHERYFLSQLQSRGFIRSCLGSISNIS
YQDGTHLLESQQRACTLEAELALLLRISHKYGKSGGQVLFSMGALEHIASCRAISFKGNM
RRVDMKLQSDVGYNVQKQRTIITAVLRLVFALTSLVETSEFFEGRNKIVRDVVEFIKGHQ
SLFDQLLREDFTQADDLLMEQIILAVGILSKVWPFEENDGYGFVQGLFDMMSKLFIASPI
KSILSQGSELKLSQLRFSLTSYLYFLVTKNSLRLQVSDDSLDSSTKLRQPTLLLLASLLS
HVTDSLERAAEKKSLLLHKIRDINELSRQDVDAIIKICDSQEYVTPSDNIHKRRYIAMVE
MCQIVGNRDQLITLLLQLAEHVLNIILIHLQDRSVSSNERGSYGSKSHIQQEVTDLCGKL
SPTIDRLALLNEGKVGHNLKVFQRLATTVKEMAIQKCV
NT seq 5517 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgccgaaagatttagtggcgatagtacactcttcgctgctcggaacatcccgg
ccaactccaacgcagcgtatcgaactcactcatgccattcgcaactcatttccctctctt
cagaacctcctctctttcccgcctccgaagccgtcggacagagcgcaagttcagtccaaa
gaaattcgactcccggattcgctgccaatatctttggatgaccaagatatcgctattagc
ttgaaactgagtgatgagcttcacctaaatgagatagattctgttcgtctgcttgtatct
tcgaatcaggagtggggcttaatgggacgagaccctcttgagattcaacggcttgcaact
ggactatggtatacagggagaagagatcttacatcaacgctatacacactcctgagggca
gttgttctggacgaggggcttgaacctgatcttatagctgacattcagggactcttagaa
gaactgattgaagctgggctcagacaacggttgattactcttataaaggaactcaatcgg
gaggatcctactggactgggtgggcccttatgcgagcgataccttattgactcaagaggt
gctcttgttgaacgaagagctgttgttcagagggaaagattgatactgggacattgcctt
gttctttcaattttggttgatagacctggttcgaaagatgtgaaggatatatactatatt
ttaaaagataatgcagctcaattaactgaaggaaatgacaccataagttctcagattact
tttagtcttctgttttctctcatcatcaccttcgtatcagatgcaatcagcagactatct
gataagtcatctatgatatctcaagatgcttcatttaggacagactttcaggatattgtc
atggcttctggcagtgaccccactgctgatggcttcattggtggcataaggcttgcctgg
gctgtacatttaatgctgatacatgatggaatatcgggaatggatacaatttccactgct
tcaacaacagatatggggcatatatgctcctgcctggagtccatcttctcaaaaaacgtg
tttcaatttttgctggataatgttcttcgaactgcagcctaccagaatgatgaggaggac
attatctacatatataatgcttatctgcacaagttagcctcttgttttttatctcacccg
atcgcaagagataaggtgaaggaatcaaaggacatggctatgagtgttctaaattcttac
cgaacttctgatccgcttgatggaagtatgcagactgaagagtctgacaggccactgccc
ttcatttctcttatggagtttaaggaacctgagctactctccgggaatgatgtcttgtgg
acttttgtgaattttgctggagaggaccacacaaattttaaaactcttgtggctttcttg
gaaatgctgtgtaccttggcttccactcaggaaggtgcttctaaagtttatgagttgctc
cggggtacatcatttcgcagtataggatggcccactttgtttgattgtataagaatttac
gatgagaagttcaagcagtctcttcaaactgctggagccatgatgccagagttcctggag
ggcgatgcaaaagcacttgtcgcttatctgaatgtacttcagaaggttgttgaaaatggt
aatcccactgagaggaaaaactggtttcctgatatcgaaccattttttaagcttctgggt
tacgaaaacatccctccatatctgaagggtgctcttagaaagaccattgctgcctttgtt
aatgtctttccagaaatgagggactctatctgggcttttcttgagcagtatgatctgcct
gttgttgtgggatcacaagttggaaagagtgaccaatcttctcaggtctatgatatgcaa
tttgagttaaatgaagtggaagcaaggagagaacagtatccttcaacaatatcgttcctt
aatcttataaatgctctgattgctggagagaaagatgtgaatgatcgtgggcgtagggca
tattcagatccctgtgagaagtggcaattggttgtggcatgccttcaacattttcacatg
atcttaagcatgtatgatattcaggaggaggatcttgatggatttactgagcatccacat
tttctggtgtcacttgaaacatcttcactgcaaacgcagctgccaattatagaattacta
aaagatttcatgagtgggaaagctctctataggaacctcatgggtatccttcaggttggg
gtcaattccatcatcagcgagcgattgagtaaaacttatgggaagatcttagaaaaggct
gtacaactttctttggaaatcttactactcgtctttgagaaggatttgcttgtttccgat
gtttggcgtccgctgtaccagcctttggatataattctctcacaagatcataatcaaatt
atagccttgttggagtatgtcagatatgattctcttcctcagattcagcgatcttcaatc
aaaatcatgaacattttaaggtgttctcgcttggttggacttgttccaatgctgatcaaa
attgatgctgcgaattccttgattgaggattatgccgcctgccttgagggacgacttgaa
gagggtgaagttgtagagaacagttgtgatgatctaggggtccttattatgcagcttctg
gttgataatatcaaccggcctgccccaagtatcacacatttgcttctgaagtttgatctt
gatgcccctgtggaagggacagttttgcagccgaagtttcactacagttgtctgaaggtc
attcttgaaatgctggagaagcttccaaaccctgatataaacttcttactctttgagttt
ggcttccagcttttgtgtgagttgaatttggatccactaactagtggtccaaccatggat
ctattgagcagcaaaaaatatcagttttttctccagcacctcgataccatcggtgttgcc
actcttccaaaaagaagtggcagccaagcactccgtattagttcccttcatcagagggcg
tggctattaaagctcctagctattgcactgcatactggttctggaagcagttcagctcac
ctagaggcatgtcagagcatactttctcatctttttgggcgggaggtaactgaagcagcg
aatgaacctttttcttccagtacatatcctcaggatggtcttgattatgctggaactagt
tcaatcagtaaaagtaaggcattggctttgcttgaaattcttcagtttagatctcctgat
gcttcgatgcagcttcctcaaattgtgtcaagcctaaagtatgactcattggtggaggac
atacttgggaaccgtgatacctctgttagcggcagtatttactattattctgagcgtggt
gatcggctaattgatctatcttccttcagcaacaaactctggcagaaactacattctgga
tttcccctagtagatagttttccaaatgttgctgagctgagtgaagttagagagacaatt
caacagctgttgaaatggggctggaagtataaccgaaaccttgaggagcaagctgcccaa
cttcatatgttagctggctggtctcagattgttgaggtgtctgcttgcagaagaatatct
tctcttgataaccggtctgaaattttgtaccggatacttgatgcctctcttagcgcctcc
gcgtctccagattgttcattaaaaatggcgtttgtactcactcaggttgcccttacctgc
attgccaaacttcgtgatgatagattttcatttcaaggggccttgagttctgataccgtg
acatgtctagatgttatgatggtcaaacatttatccactggtgcttgccactcagttcta
tttaaacttgttatggcaattctaaggcatgagtcatcagaatccttgagaaggcgccaa
tatgcattgctcttgagctatttccagtactgccagcatatgattgctcttgatgtgcca
acatcagttgtgcagttcttgttacttaatgagcaagatggtgaagatttggatatccag
aagattgacaaggagcaggctgaccttgctcgtgccaacttttttattataaagaaagaa
gctcagggcatcttggatctggtaatcaaggatgcaagtcaaggcagtgagtttgggaaa
acaatatcactttatgtgctggaagctcttgtttgtattgatcacgagagatattttctt
agtcagctccagagcagaggtttcatacgatcttgtcttggaagcattagtaatatctcc
taccaggatggaacacatttgctggagtcacaacagcgagcttgtacgttagaagcagaa
cttgcattgctacttagaattagtcacaagtacggaaagtctggaggccaggttctgttc
tccatgggtgcgctggaacatattgcttcatgtagagctatcagctttaagggaaatatg
aggcgtgtggatatgaaacttcagagtgatgtaggatataatgtgcaaaagcaacgaacg
ataatcactgctgtcctaagactggtgtttgctctaacctcattggttgagacctctgaa
ttttttgaggggaggaataaaattgttcgtgacgtcgttgagtttatcaaaggacatcaa
tctctgtttgaccaacttcttcgtgaagactttactcaagcagatgatttattgatggag
caaattattcttgcagtgggaatattgagcaaggtctggccttttgaagagaacgatgga
tatggatttgttcaagggctatttgatatgatgagcaagcttttcatcgcctccccgatt
aaatcgatattatcgcagggatcagagctcaaattgtctcagttgcgattcagcttgact
tcttacttatattttctggtgaccaaaaattctctgaggttacaggtttcagatgattct
cttgatagttccactaaactacgccaaccaacattgctgttgcttgcatctcttctttcg
catgtgactgattccctcgagagagcagcagagaagaagtccttacttcttcataagatt
agagacataaacgagctctcaagacaagatgtagatgcgatcatcaagatctgtgattcc
caagaatatgtcacaccgtccgacaacatacataaaaggagatacatagctatggttgaa
atgtgccaaatcgtgggtaacagggaccagttaatcaccttgttactgcaacttgccgag
catgtactaaatattatcctgatccatctccaagatagatccgttagttcaaatgaaagg
ggatcatatggttcaaaatcccatatacaacaggaagttacagatctctgtggcaaattg
tcacctaccatagataggcttgcattactgaatgagggaaaagtaggacataacctgaag
gtgttccagagactggcaacgactgtaaaagaaatggccatccaaaagtgtgtatga

DBGET integrated database retrieval system