KEGG   Arabidopsis thaliana (thale cress): AT5G53300Help
Entry
AT5G53300         CDS       T00041                                 

Gene name
UBC10
Definition
(RefSeq) ubiquitin-conjugating enzyme 10
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD Prok-E2_B UEV G-gamma
Motif
Other DBs
NCBI-GeneID: 835411
NCBI-ProteinID: NP_001190528
MIPS: AT5G53300.1
TAIR: AT5G53300
Araport: AT5G53300
UniProt: P35133 A0A178UMJ1
Position
5
AA seq 148 aa AA seqDB search
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDY
PFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLV
PEIAHMYKTDKNKYESTARSWTQKYAMG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaagcggatcttgaaggaattgaaggatctccagaaggatccacctacatca
tgtagcgcaggtcctgttgctgaagacatgtttcactggcaggcaacgataatgggtcct
tcagagagtccttatgctggaggtgttttccttgtaaccatccatttccctccggattac
ccattcaagcctcctaaggtggcctttaggaccaaggtgttccatcccaacattaacagc
aacggtagcatttgcctcgacatcttgaaggagcagtggagtcctgcgctcaccatttcc
aaggtgctgctatcgatctgttctttgttaaccgatccaaacccggatgatcctttggtg
cccgagatagctcacatgtacaagactgacaagaacaagtacgagtccactgcacgaagc
tggactcagaagtatgccatgggctaa

DBGET integrated database retrieval system