KEGG   Arabidopsis thaliana (thale cress): AT5G54390Help
Entry
AT5G54390         CDS       T00041                                 

Gene name
HL
Definition
PAP-specific phosphatase HAL2-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AT5G54390 (HL)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AT5G54390 (HL)
Transfer RNA biogenesis [BR:ath03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AT5G54390 (HL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 373 aa AA seqDB search
MAVDSLETEIDTAVRVVHLASSLCVKVQEKLHLPNGGHVKSKDDDSPVTVADFGVQAIVS
WVLAEVFGDQNLSIVAEEDTETLSEADSLGLLGAVSNAVNEALSEAQNYGLPKPVKPLGS
SEILKAISRCNSVGGPKGRHWVLDPVDGTLGFVRGDQYAVALALIENGKVLLGVLGCPNY
PVKKECLSNGCNQAMKTKAVAGSVSKGCVMYAKRGSGQAWMQPLIVGGIPESATLLKVSS
VDDPVLATVCEPVERANSNHLFTAGLANSMGVRKQPMRVYSMVKYAAIARGDAEVFMKFA
QSSYKEKIWDHAAGVVIVEEAGGVVTDAGGRNLDFSKGVYLEGLDRGIIACSGQVLHEKI
IGAVYASWESSSL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggactccttagaaacggagattgacacggcggtgcgtgttgtccacctcgct
tcttctctctgtgttaaagttcaagagaagcttcatcttcctaacggtggtcacgttaag
tctaaagacgatgattcccctgtcaccgtcgctgattttggtgtacaagcaattgtgagc
tgggttttagctgaagtgtttggtgatcaaaacctttcaattgttgctgaagaagacact
gagacactctctgaggctgattctttaggtcttttaggagctgtgtcgaatgcggttaat
gaagcattgtccgaagctcagaactacgggcttccgaagccagttaagccattggggtct
agtgaaattcttaaggctattagtagatgtaactctgttggaggacctaaaggaaggcat
tgggttcttgatcctgttgatggaacgttagggtttgttcgtggggatcagtatgctgtt
gctttagctttgatagagaatggtaaagttcttttgggtgtactaggatgtcctaattat
ccggttaagaaagaatgtttaagtaatggttgtaaccaagctatgaagacgaaagctgtt
gctggttcagtatcgaaaggatgtgttatgtatgcaaagagaggtagtggtcaagcttgg
atgcaacctttgatcgttggaggaataccagaatctgcaacacttcttaaggtttcttca
gttgatgatccggttttagctacagtttgtgagccagtagagagagcaaactcaaaccac
ttgttcactgcaggacttgccaatagcatgggagttagaaagcagcctatgcgagtgtat
agcatggtgaaatatgcagcgattgcacgtggagacgctgaagtgtttatgaagtttgca
cagtcaagttacaaagagaagatatgggatcacgcagctggagttgttattgtggaagaa
gctggtggtgtggtgactgatgcgggagggagaaacttagacttctcgaaaggtgtttac
ttggaaggtcttgaccgtggaatcatcgcatgttctggtcaagttttacatgagaagatt
ataggtgctgtttatgctagttgggaatcttccagtctctga

DBGET integrated database retrieval system