KEGG   Arabidopsis thaliana (thale cress): AT5G54390Help
Entry
AT5G54390         CDS       T00041                                 

Gene name
HL
Definition
PAP-specific phosphatase HAL2-like protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ath00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 373 aa AA seqDB search
MAVDSLETEIDTAVRVVHLASSLCVKVQEKLHLPNGGHVKSKDDDSPVTVADFGVQAIVS
WVLAEVFGDQNLSIVAEEDTETLSEADSLGLLGAVSNAVNEALSEAQNYGLPKPVKPLGS
SEILKAISRCNSVGGPKGRHWVLDPVDGTLGFVRGDQYAVALALIENGKVLLGVLGCPNY
PVKKECLSNGCNQAMKTKAVAGSVSKGCVMYAKRGSGQAWMQPLIVGGIPESATLLKVSS
VDDPVLATVCEPVERANSNHLFTAGLANSMGVRKQPMRVYSMVKYAAIARGDAEVFMKFA
QSSYKEKIWDHAAGVVIVEEAGGVVTDAGGRNLDFSKGVYLEGLDRGIIACSGQVLHEKI
IGAVYASWESSSL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggactccttagaaacggagattgacacggcggtgcgtgttgtccacctcgct
tcttctctctgtgttaaagttcaagagaagcttcatcttcctaacggtggtcacgttaag
tctaaagacgatgattcccctgtcaccgtcgctgattttggtgtacaagcaattgtgagc
tgggttttagctgaagtgtttggtgatcaaaacctttcaattgttgctgaagaagacact
gagacactctctgaggctgattctttaggtcttttaggagctgtgtcgaatgcggttaat
gaagcattgtccgaagctcagaactacgggcttccgaagccagttaagccattggggtct
agtgaaattcttaaggctattagtagatgtaactctgttggaggacctaaaggaaggcat
tgggttcttgatcctgttgatggaacgttagggtttgttcgtggggatcagtatgctgtt
gctttagctttgatagagaatggtaaagttcttttgggtgtactaggatgtcctaattat
ccggttaagaaagaatgtttaagtaatggttgtaaccaagctatgaagacgaaagctgtt
gctggttcagtatcgaaaggatgtgttatgtatgcaaagagaggtagtggtcaagcttgg
atgcaacctttgatcgttggaggaataccagaatctgcaacacttcttaaggtttcttca
gttgatgatccggttttagctacagtttgtgagccagtagagagagcaaactcaaaccac
ttgttcactgcaggacttgccaatagcatgggagttagaaagcagcctatgcgagtgtat
agcatggtgaaatatgcagcgattgcacgtggagacgctgaagtgtttatgaagtttgca
cagtcaagttacaaagagaagatatgggatcacgcagctggagttgttattgtggaagaa
gctggtggtgtggtgactgatgcgggagggagaaacttagacttctcgaaaggtgtttac
ttggaaggtcttgaccgtggaatcatcgcatgttctggtcaagttttacatgagaagatt
ataggtgctgtttatgctagttgggaatcttccagtctctga

DBGET integrated database retrieval system