KEGG   Arabidopsis thaliana (thale cress): AT5G54810Help
Entry
AT5G54810         CDS       T00041                                 

Gene name
TSB1
Definition
(RefSeq) tryptophan synthase beta-subunit 1
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01230  Biosynthesis of amino acids
Module
ath_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT5G54810 (TSB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT5G54810 (TSB1)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AT5G54810 (TSB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP Cas_APE2256
Motif
Other DBs
NCBI-GeneID: 835571
NCBI-ProteinID: NP_200292
MIPS: AT5G54810.1
TAIR: AT5G54810
Araport: AT5G54810
UniProt: P14671 Q0WUI8
Position
5
AA seq 470 aa AA seqDB search
MAASGTSATFRASVSSAPSSSSQLTHLKSPFKAVKYTPLPSSRSKSSSFSVSCTIAKDPP
VLMAAGSDPALWQRPDSFGRFGKFGGKYVPETLMHALSELESAFYALATDDDFQRELAGI
LKDYVGRESPLYFAERLTEHYRRENGEGPLIYLKREDLNHTGAHKINNAVAQALLAKRLG
KKRIIAETGAGQHGVATATVCARFGLECIIYMGAQDMERQALNVFRMRLLGAEVRGVHSG
TATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGKETRKQALEKWGG
KPDVLVACVGGGSNAMGLFHEFVNDTEVRMIGVEAAGFGLDSGKHAATLTKGDVGVLHGA
MSYLLQDDDGQIIEPHSISAGLDYPGVGPEHSFFKDMGRAEYYSITDEEALEAFKRVSRL
EGIIPALETSHALAYLEKLCPTLSDGTRVVLNFSGRGDKDVQTVAKYLDV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcaggcacctctgctactttcagagcctccgtttcttcagctccttcctct
tcttcccaattgacccatttgaaatcacccttcaaagctgtcaaatatacgcctctgcca
tcgtctcgctccaagtcatcatccttctccgtctcctgcaccatcgccaaggacccgcct
gttctcatggccgccggatctgacccggccctgtggcaacgacccgattcgttcggtcgg
tttgggaagtttggtgggaagtatgtacctgaaacccttatgcacgctctatctgagctt
gaatccgctttctatgctcttgccaccgacgatgatttccagagagagttggctggaatc
ttgaaggactatgtgggtagagaaagtcctctgtattttgcagagaggcttacggagcat
tacaggcgcgagaatggcgaagggcctcttatatacttgaagagagaagacttgaatcac
acaggagctcacaagattaacaacgctgtggctcaggctcttcttgctaagcggttgggg
aagaagaggattattgctgagacaggagcgggtcaacatggtgtggctacagctactgtg
tgtgcccgttttggtttggagtgtattatctatatgggtgctcaagatatggagagacaa
gcactcaatgtgttcagaatgcgacttcttggtgccgaggtgagaggagtccactctgga
acagcgacattgaaggatgcgacatctgaagcgataagagattgggtgacaaatgtggag
actacccattacatattgggatctgtggcgggtcctcatccttaccccatgatggtcaga
gactttcacgctgtgattggtaaagaaacaaggaaacaagcgttggagaaatggggcggg
aagccggatgtcttggtggcttgtgtcggtggtggttcaaacgctatgggactcttccat
gaatttgtgaatgacacagaggtccggatgatcggtgtggaagcagcgggattcggattg
gacagtggcaaacacgctgctacattgacaaagggagatgttggtgtcctccatggagct
atgagttacttgctgcaagatgatgatggacaaatcattgaaccacactccatcagtgca
ggattggactaccctggagtcggacccgagcacagtttctttaaagacatgggacgggct
gaatactatagcataaccgacgaagaagcgttggaagcgttcaagagagtgtcgcggtta
gagggaatcattccagcactggagacctcacacgcactagcttacctcgagaagctatgt
cccacattatcagacgggacgagagtggtcttgaacttcagcggaagaggagataaagat
gttcagacagtggctaaatatcttgatgtttga

DBGET integrated database retrieval system