KEGG   Arabidopsis thaliana (thale cress): AT5G55760Help
Entry
AT5G55760         CDS       T00041                                 

Gene name
SRT1
Definition
(RefSeq) sirtuin 1
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     AT5G55760 (SRT1)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     AT5G55760 (SRT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 835670
NCBI-ProteinID: NP_200387
MIPS: AT5G55760.1
TAIR: AT5G55760
Araport: AT5G55760
UniProt: Q9FE17 A0A178UR49
Position
5
AA seq 473 aa AA seqDB search
MSLGYAEKLSFIEDVGQVGMAEFFDPSHLLQCKIEELAKLIQKSKHLVVFTGAGISTSCG
IPDFRGPKGIWTLQREGKDLPKASLPFHRAMPSMTHMALVELERAGILKFVISQNVDGLH
LRSGIPREKLSELHGDSFMEMCPSCGAEYLRDFEVETIGLKETSRKCSVEKCGAKLKDTV
LDWEDALPPKEIDPAEKHCKKADLVLCLGTSLQITPACNLPLKCLKGGGKIVIVNLQKTP
KDKKANVVIHGLVDKVVAGVMESLNMKIPPYVRIDLFQIILTQSISGDQRFINWTLRVAS
VHGLTSQLPFIKSIEVSFSDNHNYKDAVLDKQPFLMKRRTARNETFDIFFKVNYSDGCDC
VSTQLSLPFEFKISTEEHVEIIDKEAVLQSLREKAVEESSCGQSGVVERRVVSEPRSEAV
VYATVTSLRTYHSQQSLLANGDLKWKLEGSGTSRKRSRTGKRKSKALAEETKA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaggttacgcagagaaattatccttcattgaagatgttggtcaagtcggcatg
gctgaattcttcgacccatctcatcttctacaatgcaagattgaagaacttgctaagttg
attcaaaagagtaagcatctagtagtctttactggtgcaggcatttcaacttcttgtggt
attcctgatttccgaggccccaaaggaatttggacgttacagcgcgagggcaaagattta
cctaaagcatctctgccatttcaccgtgcaatgccgagtatgacccatatggctttggtt
gaattagaaagagctggcattttaaaatttgttatcagtcagaatgtggatggcttacat
cttcgatctggaataccaagagagaagctttctgaactgcatggagactcttttatggag
atgtgcccatcatgtggagcagagtacctgcgtgatttcgaggtggaaactattggatta
aaggagacatcaagaaagtgttctgttgaaaagtgtggagctaaacttaaagatacggtc
ttggattgggaggatgctttgcctccaaaagaaattgatcctgcggagaagcactgcaaa
aaggctgatcttgtactctgtttgggtaccagtttgcagataacccctgcttgcaatttg
cctctcaagtgtctcaaaggtggaggcaagatcgtcatagttaatcttcagaaaacaccg
aaagacaagaaagcaaatgtagtgattcatggtcttgttgataaggtggttgcaggggtc
atggaatcgctcaacatgaagattcctccatatgtcagaattgatcttttccagataatc
ctaactcaatctataagcggagatcagaggtttattaattggaccctgcgtgttgcgagt
gttcatggattgacttctcagttaccattcatcaagtctattgaggtttctttctcagat
aaccataattacaaagacgcagttctcgataagcagccttttcttatgaaaaggagaaca
gcacgaaacgaaacttttgatatattctttaaagttaactacagtgacggttgtgactgt
gtctccactcaacttagcctcccatttgaattcaagatttcaacagaagagcatgtagag
attattgacaaggaggctgtgctacaaagcctgagagagaaagcggtagaagaatccagt
tgcgggcaaagcggtgtggttgagagaagagtggtttctgaaccgagaagtgaggctgtt
gtgtatgctacggtgactagtctcaggacttaccatagtcaacaatctctgcttgctaat
ggagacctgaaatggaagctggaaggttctggaacatcccgtaaacgctctagaaccggg
aagcgaaaatcgaaggctctggcagaagaaaccaaggcatag

DBGET integrated database retrieval system