KEGG   Arabidopsis thaliana (thale cress): AT5G55760Help
Entry
AT5G55760         CDS       T00041                                 

Gene name
SRT1
Definition
sirtuin 1
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     AT5G55760 (SRT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 473 aa AA seqDB search
MSLGYAEKLSFIEDVGQVGMAEFFDPSHLLQCKIEELAKLIQKSKHLVVFTGAGISTSCG
IPDFRGPKGIWTLQREGKDLPKASLPFHRAMPSMTHMALVELERAGILKFVISQNVDGLH
LRSGIPREKLSELHGDSFMEMCPSCGAEYLRDFEVETIGLKETSRKCSVEKCGAKLKDTV
LDWEDALPPKEIDPAEKHCKKADLVLCLGTSLQITPACNLPLKCLKGGGKIVIVNLQKTP
KDKKANVVIHGLVDKVVAGVMESLNMKIPPYVRIDLFQIILTQSISGDQRFINWTLRVAS
VHGLTSQLPFIKSIEVSFSDNHNYKDAVLDKQPFLMKRRTARNETFDIFFKVNYSDGCDC
VSTQLSLPFEFKISTEEHVEIIDKEAVLQSLREKAVEESSCGQSGVVERRVVSEPRSEAV
VYATVTSLRTYHSQQSLLANGDLKWKLEGSGTSRKRSRTGKRKSKALAEETKA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaggttacgcagagaaattatccttcattgaagatgttggtcaagtcggcatg
gctgaattcttcgacccatctcatcttctacaatgcaagattgaagaacttgctaagttg
attcaaaagagtaagcatctagtagtctttactggtgcaggcatttcaacttcttgtggt
attcctgatttccgaggccccaaaggaatttggacgttacagcgcgagggcaaagattta
cctaaagcatctctgccatttcaccgtgcaatgccgagtatgacccatatggctttggtt
gaattagaaagagctggcattttaaaatttgttatcagtcagaatgtggatggcttacat
cttcgatctggaataccaagagagaagctttctgaactgcatggagactcttttatggag
atgtgcccatcatgtggagcagagtacctgcgtgatttcgaggtggaaactattggatta
aaggagacatcaagaaagtgttctgttgaaaagtgtggagctaaacttaaagatacggtc
ttggattgggaggatgctttgcctccaaaagaaattgatcctgcggagaagcactgcaaa
aaggctgatcttgtactctgtttgggtaccagtttgcagataacccctgcttgcaatttg
cctctcaagtgtctcaaaggtggaggcaagatcgtcatagttaatcttcagaaaacaccg
aaagacaagaaagcaaatgtagtgattcatggtcttgttgataaggtggttgcaggggtc
atggaatcgctcaacatgaagattcctccatatgtcagaattgatcttttccagataatc
ctaactcaatctataagcggagatcagaggtttattaattggaccctgcgtgttgcgagt
gttcatggattgacttctcagttaccattcatcaagtctattgaggtttctttctcagat
aaccataattacaaagacgcagttctcgataagcagccttttcttatgaaaaggagaaca
gcacgaaacgaaacttttgatatattctttaaagttaactacagtgacggttgtgactgt
gtctccactcaacttagcctcccatttgaattcaagatttcaacagaagagcatgtagag
attattgacaaggaggctgtgctacaaagcctgagagagaaagcggtagaagaatccagt
tgcgggcaaagcggtgtggttgagagaagagtggtttctgaaccgagaagtgaggctgtt
gtgtatgctacggtgactagtctcaggacttaccatagtcaacaatctctgcttgctaat
ggagacctgaaatggaagctggaaggttctggaacatcccgtaaacgctctagaaccggg
aagcgaaaatcgaaggctctggcagaagaaaccaaggcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system