KEGG   Arabidopsis thaliana (thale cress): AT5G56580Help
Entry
AT5G56580         CDS       T00041                                 

Gene name
MKK6
Definition
mitogen-activated protein kinase kinase 6
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    AT5G56580 (MKK6)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AT5G56580 (MKK6)
Protein kinases [BR:ath01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   AT5G56580 (MKK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 356 aa AA seqDB search
MVKIKSNLKQLKLSVPAQESPISSFLTASGTFHDGDFLLNQKGLRLTSDEKQSRQSDSKE
LDFEITAEDLETVKVIGKGSGGVVQLVRHKWVGKFFAMKVIQMNIQEEIRKQIVQELKIN
QASSQCPHVVVCYHSFYHNGAFSLVLEYMDRGSLADVIRQVKTILEPYLAVVCKQVLLGL
VYLHNERHVIHRDIKPSNLLVNHKGEVKISDFGVSASLASSMGQRDTFVGTYNYMSPERI
SGSTYDYSSDIWSLGMSVLECAIGRFPYLESEDQQNPPSFYELLAAIVENPPPTAPSDQF
SPEFCSFVSACIQKDPPARASSLDLLSHPFIKKFEDKDIDLGILVGTLEPPVNYLR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagatcaaatcgaacttgaagcagcttaagctctccgttccagctcaagaatcc
ccaatctcttccttcctgactgcgagtggaacatttcacgatggagattttcttctgaat
caaaaggggctaaggttgacgtcagatgagaagcaatcaaggcaatctgatagcaaggag
cttgatttcgaaattactgctgaagacttagagactgtcaaagtcatcggaaaaggcagt
ggtggtgttgttcaattagttcgtcataaatgggttggcaaattctttgctatgaaggtc
atacagatgaatatacaagaagaaatccgtaagcaaattgttcaggagcttaaaataaac
caagcatcatcacaatgtccacatgtagtagtttgctaccattctttctatcacaatgga
gccttttcgcttgtgcttgaatacatggaccgtggatctcttgcggatgtgattagacaa
gtcaagactattcttgaaccttaccttgctgttgtctgtaaacaggttttgctaggtctt
gtgtacctacacaacgaaagacatgtcatacacagagacattaagccatcaaaccttctt
gtaaaccataaaggggaagtgaaaatctcagattttggtgtaagtgcaagtcttgctagc
tccatgggacagagggacacatttgttggaacctacaactatatgtcgcctgagaggatt
agtggaagcacatatgactacagcagtgacatttggagtttggggatgtcagtgttagaa
tgtgcaataggaagatttccttatttagaatctgaagatcagcaaaacccgccaagcttt
tatgaactcttggcagcaatagtagagaatccaccaccaactgctccttctgatcaattc
tcacctgaattctgctcctttgtatcagcctgcatacaaaaagatcctccagcaagagca
tcatctttggacctcttgagtcatccattcataaaaaagtttgaggacaaggatatcgat
ctcgggatacttgttggcactctggaaccacctgttaactaccttagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system