KEGG   Arabidopsis thaliana (thale cress): AT5G56600Help
Entry
AT5G56600         CDS       T00041                                 

Gene name
PRF3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT5G56600 (PRF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 145 aa AA seqDB search
MPLPHTHSLVVSTLSLEHSDKPQRRSRAKVKKKKKTNMSWQTYVDDHLMCDVAGNRLTAA
AILGQDGSVWAQSNNFPQVKPEEIQGIKDDFTTPGTLAPTGLFLGGNKYMVIQGEPNAVI
RGKKVTRLFEYCLIFDELLLILLPL
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgccattgccacacactcactcactcgtagtttcgacgctatctctagaacattccgat
aaaccacaaagaagaagcagagcaaaagtaaagaagaagaagaaaacaaacatgtcgtgg
cagacttacgtcgacgatcacttaatgtgcgatgttgcaggcaaccgcctcaccgccgcc
gcaattctcggccaagacggtagcgtctgggctcagagcaacaattttcctcaggtgaag
cctgaggaaattcagggcatcaaagacgattttactacacctggaacacttgccccaaca
ggattgttccttggtggtaacaagtacatggtaatccaaggagagcctaatgccgtcatt
cgaggaaagaaggtaactagactgtttgaatattgtttgatttttgatgaactgttgttg
attttgcttccattgtag

DBGET integrated database retrieval system