KEGG   Arabidopsis thaliana (thale cress): AT5G56740Help
Entry
AT5G56740         CDS       T00041                                 

Gene name
HAG2
Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AT5G56740 (HAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 467 aa AA seqDB search
MVQKQQASAGPGTEPKKRRRVGFSPADTGVEANECIKIYLVSSKEEVDSSDISSVKPVDL
NDFFDGDGKIYGYQGLKINVWINSISLHSYADITYQSTINGDKGITDLKSALQNIFAETI
VDTKDEFLQTFSTQRDFIRNMVSNGEVMHAGATDGSSKNAEVVPSDPQVIRMEIGSPNAG
LLYSRLVPLVLLFVDGSNPIDVTDPDWHLYLLIQKKEEKEDPLYRIVGFTAIYKFYRYPD
RLRMRLSQILVLPSFQGKGLGSYLMEVVNNVAITENVYDLTVEEPSEKFQHIRTCIDINR
LRSFDPIKPDIDSAVQTLTKGKLSKKAQIPRFTPPLNAIEKVRESLKINKKQFLKCWEIL
IYLALDPIDKYMEDYTSVITNHVRTDILGKDIETPKKQVVDVPSSFEPEASFVVFKSVNG
EEANTNVQVDENKPDQEQQLKQLVEERIREIKLVAEKVSKSGQTLKV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggttcagaagcagcaagcctccgccggtccgggtaccgagcctaagaagcgtcgccgt
gtcggattttctcccgccgatactggtgtcgaggctaacgagtgcatcaaaatttatctc
gtttcaagcaaagaggaagttgattcctctgatatttccagcgtgaagccagttgacttg
aatgatttctttgatggagatggcaagatttatggttaccaaggtttgaagataaatgta
tggatcaatagcatctcattacattcatatgctgatatcacataccagagcaccattaac
ggagacaaaggcatcacggacctcaaatctgctttacagaacatatttgctgagaccatt
gttgataccaaggatgagtttctgcaaaccttttcgacacagagagattttatcagaaat
atggtctcgaatggagaggtaatgcatgctggagcaacagatggaagcagcaagaatgct
gaagtggttccttctgatccccaggttatacggatggaaattggttctccaaatgctgga
ctcctctatagccgattggtaccccttgttcttctttttgtcgatggcagcaatccgatt
gatgtcactgatcctgactggcatttatatctcttaatccagaagaaagaggaaaaagaa
gatcctttgtatcgaattgtgggctttaccgcaatttataagttctatcgttatcctgac
aggctgcggatgcgactcagccagatcttggtcttaccatccttccaaggaaaaggactc
ggaagctatcttatggaggtagtaaacaacgtggccataacagaaaacgtttacgatttg
acagttgaggagccatctgaaaagttccaacacatccgcacttgcatagacataaaccgc
ttgcgcagtttcgatccaatcaaaccagacattgattcagctgttcagactctcacaaaa
ggaaagctatcaaagaaagctcagatacctcgattcaccccgcctctgaacgccattgag
aaagtccgcgaatctctgaagatcaacaagaaacagttcctcaaatgctgggagattttg
atataccttgctcttgatcctattgacaagtacatggaagattacacatcagtcatcacg
aaccatgtgagaaccgacattctgggaaaagatatagaaactccaaagaaacaagtcgtt
gatgttccaagctctttcgagccagaagcatcgtttgtggttttcaagtctgtaaacgga
gaagaggctaataccaatgttcaagttgatgaaaacaaaccggatcaagagcagcagctg
aagcaacttgttgaggaaaggattcgtgagatcaagttggttgctgagaaagtctccaag
agtggtcaaacgctaaaagtctga

DBGET integrated database retrieval system