KEGG   Arabidopsis thaliana (thale cress): AT5G57330Help
Entry
AT5G57330         CDS       T00041                                 

Definition
galactose mutarotase-like superfamily protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ath00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 312 aa AA seqDB search
MATERHHFELAKGINGLDKIVLRESRGRSAEVYLYGSHVTSWKNENGEELLHLSSKAIFK
PPKPIRGGIPLCFPQFSNFGTLESHGFARNRIWEVEANPPPLPLNSCSSAFVDLILRPTE
DDLKIWPNNFEFRLRIALGTEGELTLTSRIRNTNSDGKPFTFTFAYHTYFSVSDISEVRV
EGLETLDYLDNLKDRERFTEQGDAITFESEVDKIYLSTPTKIAILDHEKKRTFVIRKDGL
ADAVVWNPWDKKSKTISDLGDEDYKHMLCVEAAAIERPITLKPGEEWKGRLELSAVPSSY
SSGQLDPKKVLE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagcgtcatcattttgagcttgctaaaggcatcaatggccttgataagatc
gttctccgcgagtctcgcggccgctctgcagaggtatacttgtatggaagtcatgtaact
tcttggaagaatgagaacggagaggagttacttcacctcagtagcaaggccatattcaag
cccccgaaaccaatacgtggagggattcccctatgttttccacaattcagtaactttggt
acactcgaatcacatggctttgctagaaataggatctgggaagtcgaggctaacccacct
ccgttgccattaaattcttgttctagtgcttttgttgacctgatcctaaggccaactgaa
gacgatctgaaaatctggcctaacaattttgagttcaggctgaggatagccttggggacc
gaaggagaattaactctgacatctcgtatcaggaacaccaactctgatggaaagccgttt
acattcacatttgcttatcacacctatttctctgtctcagacatcagtgaagtacgggtt
gaaggattggaaacgttggattatcttgacaacttgaaggacagagaacgttttaccgaa
caaggcgatgcgataacttttgaatccgaagttgacaagatttatctaagcacgccaaca
aagattgctattttggatcacgagaaaaagaggactttcgttattcgcaaggacgggctt
gctgatgctgtggtgtggaatccttgggataagaaatcaaagacgatctctgacttggga
gatgaagactataagcatatgctttgtgtggaagctgcggctatcgagagaccgatcaca
ttgaaacccggtgaagaatggaaaggaagactcgaactctctgcagttccttctagttac
tccagtggacagcttgaccccaagaaagtccttgagtga

DBGET integrated database retrieval system