KEGG   Arabidopsis thaliana (thale cress): AT5G57360Help
Entry
AT5G57360         CDS       T00041                                 

Gene name
ZTL
Definition
(RefSeq) adagio protein 1
  KO
K12115  
clock-associated PAS protein ZTL
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:ath00001]
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    AT5G57360 (ZTL)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     AT5G57360 (ZTL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 609 aa AA seqDB search
MEWDSGSDLSADDASSLADDEEGGLFPGGGPIPYPVGNLLHTAPCGFVVTDAVEPDQPII
YVNTVFEMVTGYRAEEVLGGNCRFLQCRGPFAKRRHPLVDSMVVSEIRKCIDEGIEFQGE
LLNFRKDGSPLMNRLRLTPIYGDDDTITHIIGIQFFIETDIDLGPVLGSSTKEKSIDGIY
SALAAGERNVSRGMCGLFQLSDEVVSMKILSRLTPRDVASVSSVCRRLYVLTKNEDLWRR
VCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAAAWRKLSVGGSVEPSRCNFSACA
VGNRVVLFGGEGVNMQPMNDTFVLDLNSDYPEWQHVKVSSPPPGRWGHTLTCVNGSNLVV
FGGCGQQGLLNDVFVLNLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSG
VLLSDTFLLDLSIEKPVWREIPAAWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLKFRSS
DVFTMDLSEEEPCWRCVTGSGMPGAGNPGGVAPPPRLDHVAVNLPGGRILIFGGSVAGLH
SASQLYLLDPTEDKPTWRILNIPGRPPRFAWGHGTCVVGGTRAIVLGGQTGEEWMLSELH
ELSLASYLT
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggagtgggacagtggttccgatctaagcgccgatgatgcttcgtcactggcggatgat
gaagagggaggtctttttcccggaggtggaccaattccatatcccgttgggaatttgctt
cacacggcgccttgtggattcgttgttactgatgccgttgagccggaccaacctattata
tatgtcaacaccgtcttcgaaatggttacagggtatcgtgctgaggaagttctcggagga
aattgccgcttcttgcaatgtagaggaccgtttgctaaaagaaggcatccattagttgac
tctatggttgtttccgagataagaaaatgtattgatgagggcattgaatttcaaggcgag
ttgttgaactttaggaaagatggatctccgttgatgaatagattgcggttgactcctatt
tatggagacgatgatactattacccatataattggaatccagttctttatcgagacagac
attgaccttggacctgttcttggatcttcaacaaaagaaaagtcaattgatgggatatac
tcagctttagctgctggggagcggaatgtttcccgaggaatgtgtgggttattccagctg
agtgacgaggttgtgtctatgaagatattgtcacgcctgacaccaagagacgttgcatct
gttagctctgtgtgccgcaggctatatgtgctgacaaagaatgaggatctttggcgaagg
gtttgtcagaatgcatggggaagtgaaacaacacgggtattagagactgttcctggtgct
aaaagactcggttggggccgcttggctagagaactgaccacccttgaagctgcagcttgg
agaaaactttcggttggaggttctgttgagccttctcgctgtaattttagtgcttgtgct
gtcgggaacagagttgttctgtttggaggagaaggtgtgaatatgcagcctatgaatgat
acctttgttttagatctgaattctgattaccctgaatggcaacatgtcaaagtgagctcc
cctcctccaggacgctggggccacacgctcacttgtgtaaatggctccaatctggttgta
tttggtggctgtggtcagcaaggtttgctgaacgatgtgtttgtcttgaatctcgatgct
aagccgcctacttggagggaaatttcgggtttggctccgcctctaccaagatcatggcac
agctcatgcacccttgacggaaccaaactgatagtctctggaggctgtgcagattccggc
gttcttctaagtgacacgttcctcctcgacctttcaatagagaaaccagtgtggagagag
attccagctgcctggactccgccttcccggttaggccacacactatcggtttatggagga
agaaagatcttgatgtttggtggtcttgctaagagcgggcctttgaaattccgttcgagt
gatgtcttcacaatggatctaagcgaagaggagccttgttggaggtgtgtgaccggtagc
ggaatgcctggagcaggaaacccaggaggagtagcaccaccaccaaggctagatcacgtt
gcagttaacctccctggaggcagaatcttgatatttggcggctcagtggcagggcttcac
tcagcgtctcagctttatctacttgacccaacggaggacaaaccgacttggagaatacta
aacattccaggaagaccgcctcggtttgcttggggacatggcacttgtgttgtgggagga
acacgagcgatagtgctaggtggtcagaccggagaagaatggatgctaagtgagctacac
gaattatcactagcgagctatctcacgtaa

DBGET integrated database retrieval system