KEGG   Arabidopsis thaliana (thale cress): AT5G57560Help
Entry
AT5G57560         CDS       T00041                                 

Gene name
TCH4
Definition
(RefSeq) xyloglucan endotransglucosylase/hydrolase protein 22
  KO
K14504  
xyloglucan:xyloglucosyl transferase TCH4 [EC:2.4.1.207]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT5G57560 (TCH4)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.207  xyloglucan:xyloglucosyl transferase
     AT5G57560 (TCH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 284 aa AA seqDB search
MAITYLLPLFLSLIITSSVSANFQRDVEITWGDGRGQIKNNGELLTLSLDKSSGSGFQSK
NEYLFGKVSMQMKLVPGNSAGTVTTLYLKSPGTTWDEIDFEFLGNSSGEPYTLHTNVYTQ
GKGDKEQQFKLWFDPTANFHTYTILWNPQRIIFTVDGTPIREFKNMESLGTLFPKNKPMR
MYSSLWNADDWATRGGLVKTDWSKAPFTASYRGFQQEACVWSNGKSSCPNASKQGTTTGS
WLSQELDSTAQQRMRWVQRNYMIYNYCTDAKRFPQGLPKECLAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcacttacttgcttcctctgtttctttctcttatcatcacctcctctgtttca
gctaatttccaaagagacgttgagatcacttggggtgatggtcgtggacagatcaagaac
aatggagagcttctcactttatctctagataaatcctctggttctggattccaatccaaa
aacgagtacttgtttggtaaagtctccatgcaaatgaagcttgtccctggaaactccgca
ggaacagtcacaacactttacttgaaatcacctggaacaacatgggacgagatagatttc
gagtttttagggaattcaagtggagaaccttacacacttcacacaaatgtctacacacaa
ggcaaaggagacaaagaacaacaattcaaactctggtttgatccaacagctaatttccac
acttacactattctctggaacccacaaagaatcattttcaccgtcgatggaactccgatc
agagaattcaagaacatggagtctctaggcactctgtttcccaagaacaaaccaatgaga
atgtactcgagtctttggaacgctgatgattgggcaacgagaggtggtttggtcaaaacc
gattggtctaaagctcctttcactgcttcttaccgtggctttcaacaagaagcttgtgtt
tggtcaaacggcaagtcttcttgtcctaatgcctcgaaacaggggactactactggctcg
tggttgtcacaagagcttgactcaacagctcaacaaaggatgagatgggtgcagaggaac
tacatgatctataattattgtacggatgcgaagaggttccctcaaggtcttcctaaagag
tgcttagctgcatag

DBGET integrated database retrieval system