KEGG   Arabidopsis thaliana (thale cress): AT5G57655Help
Entry
AT5G57655         CDS       T00041                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT5G57655
   00051 Fructose and mannose metabolism
    AT5G57655
Enzymes [BR:ath01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     AT5G57655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 477 aa AA seqDB search
MKKVEFFMLLLCFIAASSLVSADPPTCPADLGGKCSDSDDWQGDFFPEIPKIKYEGPSSK
NPLAYRWYNAEEEILGKKMKDWFRFSVAFWHTFRGTGGDPFGAATKYWPWEDGTNSVSMA
KRRMRANFEFLKKLGVDWWCFHDRDIAPDGTTLEESNKNLDEVIELAKELQKGSKIKPLW
GTAQLFLHPRYMHGGATSSEVGVYAYAAAQVKKAMEVTHYLGGENYVFWGGREGYQTLLN
TDMGRELDHLARFFEAAVAYKKKIGFKGTLLIEPKPQEPTKHQYDWDAATAANFLRKYGL
IDEFKLNIECNHATLSGHTCHHELETARINGLLGNIDANTGDAQTGWDTDQFLTDVGEAT
MVMMSVIKNGGIAPGGFNFDAKLRRESTDVEDLFIAHISGMDTMARGLRNAVKILEEGSL
SELVRKRYATWDSELGKQIEEGKADFEYLEKKAKEFGEPKVSSAKQELAEMIFQSAM
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagttgagttttttatgctccttctctgcttcatcgcagcgtcatctctagtg
tctgctgatccaccaacatgtcctgctgatttgggaggcaagtgtagtgattctgatgac
tggcaaggtgatttcttccctgaaatccccaagattaagtatgagggaccttcgagtaag
aacccacttgcttacaggtggtataacgctgaagaagagattcttgggaagaaaatgaag
gattggtttagattcagtgttgcgttttggcatactttccgtgggactggaggtgatcca
tttggtgctgctactaagtattggccttgggaagatggtactaactctgtgtctatggct
aagagaagaatgagagctaactttgagttcttgaagaaacttggagttgattggtggtgt
tttcatgacagagacatagcacctgatggcactacacttgaggaatctaacaaaaacttg
gatgaagttatcgaactcgccaaagaactccaaaaggggagcaaaatcaaaccattgtgg
ggaacagctcagcttttcttgcatcctcgttatatgcacggaggagcgaccagctctgaa
gttggagtgtatgcttacgctgctgctcaggtgaagaaagccatggaggtaacacattac
ttaggtggtgaaaactacgttttttggggtggtcgtgaaggttatcagacactcttgaac
actgatatgggaagagagcttgatcatctagccaggttctttgaagctgctgttgcttac
aagaagaagattggattcaaaggcacgcttttaatcgagcccaagcctcaagaacccacc
aagcaccagtatgactgggatgctgcaacagctgccaatttcttgaggaaatatggtctt
attgatgagtttaagctcaacattgagtgtaaccatgccacgctctctggtcacacttgt
catcacgagcttgaaactgcaagaattaatggtttacttggcaacattgatgcaaacact
ggcgatgctcaaactggatgggatacagatcagtttcttacagatgttggagaagcaacc
atggttatgatgagtgtcatcaaaaatggtgggattgctccaggcggcttcaactttgac
gctaaactgcgaagagagagtacagacgtggaagacttattcattgctcatattagtgga
atggatacaatggctcgtggactgagaaatgcagtcaaaatcttggaggagggaagtcta
agtgaattggtacgcaagcgatatgcaacttgggactctgagcttgggaagcaaatagaa
gaaggaaaagctgattttgagtatcttgagaagaaagctaaagagtttggagaaccaaag
gtttcttctgctaaacaggaactcgctgagatgattttccaatctgcaatgtaa

DBGET integrated database retrieval system