KEGG   Arabidopsis thaliana (thale cress): AT5G57990Help
Entry
AT5G57990         CDS       T00041                                 

Gene name
UBP23
Definition
ubiquitin carboxyl-terminal hydrolase 23
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AT5G57990 (UBP23)
Peptidases [BR:ath01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AT5G57990 (UBP23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 859 aa AA seqDB search
MEVATSSTEITIQTDRDPSSNNNGSCAVASSTASAVFRKIEFHPARKPFNGFSNGRSDFK
IETLNPCSSNQRLLSAPSAKKPDSSDLLEHGFEPDLTFSITFRKIGAGLQNLGNTCFLNS
VLQCLTYTEPLAATLQTAAHQKYCHVAGFCALCAIQKHVRTARQANGRILAPKDLVSNLR
CISRNFRNCRQEDAHEYMINLLECMHKCSLPSGVPSESSDAYRRSLVHKIFGGSLRSQVK
CEQCSHCSNKFDPFLDLSLDISKADSLQRALSRFTAVELLDNGAKVYQCERCKQKVKAKK
QLTVSKAPYVLTVHLKRFEAHRSEKIDRKVDFTSAIDMKPFVSGPHEGNLKYTLYGVLVH
YGRSSHSGHYACFVRTSSGMWYSLDDNRVVQVSEKTVFNQKAYMLFYVRDRQNAVPKNSV
PVVKKESFATNRASLIVASNIKDQVNGSTVIKECGFGALVANGLAPLKSCGPSTPAVLTQ
KDLNAKETQNNAISNVEAKEILETENGSAPVKTCDLAAPTVLVQKDLNTKEIFQKEVPLP
QANGEGSLVKEDSKAACLILPEKVSPHLDGSANAQTLVKLPTLGPKAENSVEEKNSLNNL
NEPANSLKVINVSVGNPPVEKAVLIDQTMGHHLEESATSIESLKLTSERETLTTPKKTRK
PKTKTLKVEFKFFKLALGLRKKKVQRRERLSTTVAGEIISEELLSKKRVKYQDTSLIAPS
KMISSSDGAVTSDQQQPVGSSDLSEASQNAKRKRESVLLQKEAVNILTRGVPETVVAKWD
EEISASQKRGSKSEGASSIGYVADEWDEEYDRGKKKKIRIKEESYRGPNPFQMLASKRQK
ETKKKWTQSITDAKTAYRI
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgctacgagcagcaccgaaatcacgatccaaacggatcgggatccgtcgtcg
aacaacaacggatcttgcgctgttgcttcctctaccgcttccgccgtcttcagaaagatc
gagtttcaccctgcaaggaaacccttcaacggtttctctaatgggcgttccgattttaag
atcgagactttgaatccttgctcctctaaccagcgactgttatctgcaccgtccgctaag
aaacccgacagctccgatttgttggaacatgggttcgaacccgatcttacttttagcatt
accttccgcaaaatcggtgcgggtttgcagaatctcgggaatacatgttttcttaattcc
gtattgcaatgtttgacatacactgagcctttagctgctactctgcaaaccgctgcgcat
cagaaatattgtcatgttgctggattttgtgctttatgtgcgatccagaaacatgtcagg
actgcccgtcaagctaatggcagaatattagcaccaaaagatttggtctcaaacttgcga
tgcatatcccgaaacttcagaaattgccggcaggaggatgcacatgagtacatgatcaat
ttgcttgaatgcatgcacaagtgtagtctaccttctggtgtaccaagtgaatcctctgat
gcttacaggagaagtttggtacacaagatttttggcggtagccttcgaagtcaggtgaaa
tgcgagcaatgttcccattgctccaacaagtttgatccgtttcttgacctaagtctagat
atttcaaaggcagattcattgcagagagcactttcgcgtttcactgctgttgagctctta
gataatggtgcaaaggtttaccaatgtgaaagatgcaagcagaaagttaaggctaaaaaa
cagctaactgtttctaaagcaccttacgttctaaccgtacatctgaagcggtttgaagca
cacagatccgaaaaaatcgataggaaagtagattttacctctgcaattgacatgaaacct
ttcgtcagtggtcctcatgaaggtaatttgaagtatactctatatggcgtgttagttcat
tatggtcgaagcagccattctggtcactacgcctgctttgttcgcacatcaagtggcatg
tggtattcccttgatgacaacagggttgtccaagttagtgagaagactgtgttcaatcaa
aaggcatatatgctattctatgtccgtgatagacaaaatgctgtccctaagaattcagtc
cctgtggttaagaaagagagctttgccacaaacagagcttctttgatcgtagcttctaac
ataaaagatcaagtgaatggctcaacagtcatcaaagaatgtgggtttggcgctcttgtt
gccaatggtttagcacctttgaaatcatgtggcccaagtactcctgctgtcttaactcag
aaagatttaaatgccaaagagactcagaacaatgccataagtaatgtggaggcaaaagag
atccttgagacggaaaatggttcggcacccgtgaaaacttgtgatttagctgcccctact
gtcttggttcagaaagacctaaatacaaaagagatcttccaaaaggaagtgccacttccg
caggctaatggggaaggatctttggtaaaggaggattcaaaggctgcatgcctaatatta
ccagagaaggtgtctcctcacctggatggaagcgcaaatgctcagactcttgtgaagttg
cctacccttggacctaaagctgaaaatagtgttgaagagaagaattctcttaacaatttg
aatgagcctgctaattcactgaaggttataaatgtgtcagttggtaatccacctgttgaa
aaagctgttcttattgatcaaactatgggacatcacttggaagaatcggccacttcaatt
gagtcattgaagttaacttccgagagggagactctcaccacaccgaaaaagactcgcaag
cctaaaacgaaaactctgaaggtggaattcaagtttttcaagctggccctgggcttacga
aaaaagaaggtacagagaagggagagattaagtacgacggtagctggcgagattatctct
gaggagctcctatcaaagaagagagttaaatatcaagatacaagtctcattgccccaagt
aaaatgatatcgagtagtgatggtgccgttacgtcagaccaacagcaacccgtgggtagt
tctgacttgtctgaggcaagccaaaacgccaaaagaaagagagagtcagttttgttacag
aaagaagctgtgaacattctcactcggggtgtgccagagacagtggttgccaaatgggat
gaggaaatttcagcttctcagaagaggggatcaaagagtgaaggcgcaagcagcattggt
tatgtagcggatgagtgggatgaagaatatgaccgagggaagaaaaagaagataaggatt
aaagaggagagctatagagggcctaacccgttccagatgcttgcatcgaagagacaaaaa
gagacaaagaagaaatggacacaaagcataactgacgcaaagacagcctacaggatatga

DBGET integrated database retrieval system