KEGG   Arabidopsis thaliana (thale cress): AT5G58330Help
Entry
AT5G58330         CDS       T00041                                 

Definition
(RefSeq) lactate/malate dehydrogenase family protein
  KO
K00051  
malate dehydrogenase (NADP+) [EC:1.1.1.82]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AT5G58330
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT5G58330
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT5G58330
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.82  malate dehydrogenase (NADP+)
     AT5G58330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 442 aa AA seqDB search
MAMAELSTPKTTSPFLNSSSRLRLSSKLHLSNHFRHLLLPPLHTTTPNSKISCSVSQNQA
PVAVQENGLVKTKKECYGVFCLTYDLKAEEETRSWKKLINIAVSGAAGMISNHLLFKLAS
GEVFGPDQPIALKLLGSERSIQALEGVAMELEDSLFPLLREVDIGTDPNEVFQDVEWAIL
IGAKPRGPGMERADLLDINGQIFAEQGKALNKAASPNVKVLVVGNPCNTNALICLKNAPN
IPAKNFHALTRLDENRAKCQLALKAGVFYDKVSNMTIWGNHSTTQVPDFLNARINGLPVK
EVITDHKWLEEGFTESVQKRGGLLIQKWGRSSAASTAVSIVDAIKSLVTPTPEGDWFSTG
VYTDGNPYGIEEGLVFSMPCRSKGDGDYELVKDVEIDDYLRQRIAKSEAELLAEKRCVAH
LTGEGIAYCDLGPVDTMLPGEV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcagagctctcaacccccaaaacgacgtcgccttttctcaactcttcgtct
cggcttcgtctctcttcaaaattgcacctttcaaaccactttcgccatcttcttcttcca
cctctccacacaacaactcccaactccaaaatctcttgctccgtttctcaaaaccaagct
cctgttgctgtgcaagaaaatggattggtgaagacgaagaaagagtgttatggagtgttc
tgcctcacctatgatcttaaagctgaagaagagacaagatcatggaagaagttaattaat
attgcagtttcaggtgctgcaggaatgatttctaaccatcttctcttcaaacttgcttca
ggggaagtatttggtccagatcaacccattgcattgaaactgctaggatcagagagatca
attcaagctcttgaaggtgttgcaatggaactggaggattcattgttcccattgttgaga
gaagttgatataggaacagatccaaatgaagtgttccaagatgtggagtgggctattctg
attggagcaaaacctcgaggccctggaatggaacgtgctgacttgttggacatcaatggc
caaatctttgctgagcagggcaaagctctgaacaaagctgcctctcctaacgtcaaggtt
cttgtagtgggaaacccttgcaacaccaatgccttgatttgtcttaaaaatgctcccaac
attcctgcaaagaacttccatgccctcacgaggttagacgaaaatcgtgccaaatgccag
cttgctcttaaagccggtgttttctatgacaaagtgtctaatatgaccatatggggaaat
cactccacgactcaggtgccagacttcttaaatgccagaattaatggcctgcctgtgaag
gaggttattacagatcacaaatggttagaagagggattcactgagagtgtgcagaagaga
ggtgggttattaattcagaaatggggtcgatcttctgctgcttctactgctgtttccatt
gttgatgctataaagtctcttgtaactcctactcctgagggtgattggttttcgactggg
gtgtacacggatggaaatccttatggtattgaagagggccttgtcttcagtatgccatgc
cggtcgaagggagatggagattatgaacttgtcaaggatgtagaaattgatgactacctt
cgccaacgaatcgccaagtcggaagcggaactgttggctgagaagagatgtgttgcacac
ctcactggagagggcattgcctactgtgatcttggtccggtagatactatgcttcctggg
gaagtttga

DBGET integrated database retrieval system