KEGG   Arabidopsis thaliana (thale cress): AT5G58690Help
Entry
AT5G58690         CDS       T00041                                 

Gene name
PLC5
Definition
phosphoinositide phospholipase C 5
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ath00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ath04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MIPS: 
TAIR: 
UniProt: 
Position
5
AA seq 578 aa AA seqDB search
MKRDMGSYKMGLCCSDKLRMNRGAPPQDVVTAFVEYTEGRSHMTAEQLCRFLVEVQDETE
VLVSDAEKIIERITCERHHITKFLRHTLNLDDFFSFLFSDDLNHPIDSKVHQDMASPLSH
YFIYTSHNSYLTGNQINSECSDVPLIKALKRGVRALELDMWPNSTKDDILVLHGWAWTPP
VELVKCLRSIKEHAFYASAYPVILTLEDHLTPDLQAKAAEMMKEIFMDMVYFPEAGGLKE
FPSPEDLKYKIVISTKPPKGSLRKDKDSESDASGKASSDVSADDEKTEEETSEAKNEEDG
FDQESSNLDFLTYSRLITIPSGNAKNGLKEALTIDNGGVRRLSLREQKFKKATEMYGTEV
IKFTQKNLLRIYPKATRVNSSNYRPYNGWMYGAQMVAFNMQGYGRALWMMHGMFRGNGGC
GYVKKPDFMMNNNLSGEVFNPKAKLPIKKTLKVKVYMGKGWDSGFQRTCFNTWSSPNFYT
RVGITGVRGDKVMKKTKKEQKTWEPFWNEEFEFQLTVPELALLRIEVHDYNMPEKDDFSG
QTCLPVSELRQGIRSVPLYDRKGERLVSVTLLMRFHFL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagatatggggagttacaaaatgggtttgtgttgcagtgacaagctcaggatg
aacagaggagctccacctcaggatgtggtgacggcgtttgtagagtataccgagggcagg
agccacatgacggcagagcagctatgtcggttcttggttgaggtgcaggacgagactgaa
gtgttggtttcagatgcagagaagatcatagaaagaatcacatgtgaaagacatcatatc
actaagttcttgaggcatacgctgaacctcgatgatttcttcagtttcttgttctcagat
gatctgaatcatccaattgatagtaaggtgcatcaagacatggcctctcccttgtcgcac
tatttcatttacaccagccataattcgtatctgactggaaatcagatcaacagcgaatgc
agcgacgtacctctcataaaggcattaaagagaggtgttcgagctcttgaacttgacatg
tggcctaactctactaaggacgacatacttgttctccatggctgggcatggacacctcca
gttgaactagtcaaatgcttgagatctataaaagaacatgccttttatgcatctgcatac
cctgtgatcttaactttggaagatcatttgactccagatcttcaagccaaagcagctgag
atgatgaaagagatattcatggatatggtgtattttccagaggctggtggtttaaaagag
tttccttcaccagaagatctcaagtacaaaattgtaatatctacaaagcctcctaaaggt
agcttaagaaaggacaaggattctgagtcagatgcatcaggaaaggcgtcatcagatgtt
tcagcagacgatgagaagactgaggaagaaacaagtgaggccaaaaatgaagaggatgga
tttgatcaagaatccagcaacttggatttcctcacctatagtcgcctaataacgattcct
tctggaaatgctaaaaatggattaaaggaagcactaacaatcgataatggtggagttaga
cggctgagtttgagggagcagaagttcaagaaagccactgaaatgtatggaaccgaagtc
ataaaattcacacagaagaatctgttgagaatatatcccaaggctacccgagtaaattcc
tccaactataggccatacaacggttggatgtacggagctcaaatggtcgctttcaacatg
cagggctatggaagagctctttggatgatgcatggtatgtttaggggaaatggtggatgc
gggtacgtgaaaaaaccggactttatgatgaacaataatctcagtggagaagtgttcaac
ccgaaagcgaagttacccataaagaaaactctaaaagtgaaagtatacatgggcaaagga
tgggactctggtttccagcgaacatgtttcaacacttggtcctctcctaacttctacaca
agggtggggataacaggagtaagaggtgataaggtaatgaagaaaacaaagaaagaacaa
aagacatgggagccattctggaacgaggagtttgagtttcagctaacagtaccggagctg
gcgttgctaagaatagaagttcacgactacaacatgccagagaaggacgatttctcgggt
cagacatgtttgcctgtgtcagagctgagacaaggcatacgttctgttcctttgtatgat
cgcaaaggcgagagactagtttcagttacacttctcatgcggtttcactttctttaa

DBGET integrated database retrieval system